[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for cper0:BAB81626.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2cg3A.bssp"
#ERROR : Can't open dsspfile "2cg2A.bssp"
#ERROR : Can't open dsspfile "2cfuA.bssp"
#ERROR : Can't open dsspfile "2c0mA.bssp"
#ERROR : Can't open dsspfile "2cfzA.bssp"
#ERROR : Can't open dsspfile "3beeA.bssp"
#ERROR : Can't open dsspfile "2dl1A.bssp"
#ERROR : Can't open dsspfile "2bedA.bssp"
#ERROR : Can't open dsspfile "3beeB.bssp"
#ERROR : Can't open dsspfile "2crbA.bssp"
#ERROR : Can't open dsspfile "3dswA.bssp"
#ERROR : Can't open dsspfile "3dstA.bssp"
#ERROR : Can't open dsspfile "1a37A.bssp"
#ERROR : Can't open dsspfile "3cvlA.bssp"
#ERROR : Can't open dsspfile "3c3oA.bssp"
#ERROR : Can't open dsspfile "3ckbB.bssp"
#ERROR : Can't open dsspfile "2avpA.bssp"
#ERROR : Can't open dsspfile "2dbaA.bssp"
#ERROR : Can't open dsspfile "2d4cD.bssp"
#ERROR : Can't open dsspfile "3edtH.bssp"
#ERROR : Can't open dsspfile "3e4bA.bssp"
#ERROR : Can't open dsspfile "3dsvA.bssp"
#ERROR : Can't open dsspfile "3cv0A.bssp"
#ERROR : Can't open dsspfile "2e0zC.bssp"
#ERROR : Can't open dsspfile "1dceA.bssp"
#ERROR : Can't open dsspfile "2c08A.bssp"
#ERROR : Can't open dsspfile "3cvnA.bssp"
#ERROR : Can't open dsspfile "3ck7D.bssp"
#ERROR : Can't open dsspfile "3dsxA.bssp"
#ERROR : Can't open dsspfile "3cvqA.bssp"
#ERROR : Can't open dsspfile "2bugA.bssp"
#ERROR : Can't open dsspfile "3dssA.bssp"
#ERROR : Can't open dsspfile "2e2eA.bssp"
#ERROR : Can't open dsspfile "3cvpA.bssp"
#ERROR : Can't open dsspfile "1e96B.bssp"
#ERROR : Can't open dsspfile "3c72A.bssp"
#ERROR : Can't open dsspfile "2btpA.bssp"
#ERROR : Can't open dsspfile "2aw6B.bssp"
#ERROR : Can't open dsspfile "3e6yA.bssp"
#ERROR : Can't open dsspfile "2axvB.bssp"
#ERROR : Can't open dsspfile "2axvA.bssp"
#ERROR : Can't open dsspfile "1b89A.bssp"
#ERROR : Can't open dsspfile "3dsuA.bssp"
#ERROR : Can't open dsspfile "1a38A.bssp"
#ERROR : Can't open dsspfile "2b05A.bssp"
#ERROR : Can't open dsspfile "2axuE.bssp"
#ERROR : Can't open dsspfile "2axuL.bssp"
#ERROR : Can't open dsspfile "3e4bD.bssp"
#ERROR : Can't open dsspfile "3draA.bssp"
#ERROR : Can't open dsspfile "2cptA.bssp"
#ERROR : Can't open dsspfile "2axuG.bssp"
#ERROR : Can't open dsspfile "3ee7D.bssp"
#ERROR : Can't open dsspfile "2bq0B.bssp"
#ERROR : Can't open dsspfile "2axzB.bssp"
#ERROR : Can't open dsspfile "2awiC.bssp"

## Summary of PDB Search
:116
    2e-12   6%  2cg3A  [x.x.x] SDSA1
    5e-12   4%  2cg2A  [x.x.x] SDSA1
    5e-11   8%  2cfuA  [x.x.x] SDSA1
    4e-09  17%  2c0mA  [x.x.x] PEROXISOMAL TARGETING SIGNAL 1 RECEPTOR
    4e-09   8%  2cfzA  [x.x.x] SDSA1
    2e-08   7%  3beeA  [x.x.x] PUTATIVE YFRE PROTEIN
    6e-08  12%  2dl1A  [x.x.x] SPARTIN
    8e-08   8%  2bedA  [x.x.x] PROTEIN
    1e-07   7%  3beeB  [x.x.x] PUTATIVE YFRE PROTEIN
    1e-07  11%  2crbA  [x.x.x] NUCLEAR RECEPTOR BINDING FACTOR 2
    1e-07   5%  3dswA  [x.x.x] GERANYLGERANYL TRANSFERASE TYPE-2 SUBUNIT ALPHA
    3e-07   9%  3dstA  [x.x.x] GERANYLGERANYL TRANSFERASE TYPE-2 SUBUNIT ALPHA
    4e-07  11%  1a37A  [a.118.7] 14-3-3 PROTEIN ZETA
    4e-07  18%  3cvlA  [x.x.x] PEROXISOME TARGETING SIGNAL 1 RECEPTOR PEX5
    5e-07   6%  3c3oA  [x.x.x] PROGRAMMED CELL DEATH 6-INTERACTING PROTEIN
    8e-07   8%  3ckbB  [x.x.x] SUSD
    1e-06  42%  2avpA  [x.x.x] SYNTHETIC CONSENSUS TPR PROTEIN
    2e-06  24%  2dbaA  [x.x.x] SMOOTH MUSCLE CELL ASSOCIATED PROTEIN-1, ISOFORM
    2e-06  11%  2d4cD  [x.x.x] SH3-CONTAINING GRB2-LIKE PROTEIN 2
    2e-06  15%  3edtH  [x.x.x] KINESIN LIGHT CHAIN 2
    4e-06   6%  3e4bA  [x.x.x] ALGK
    4e-06   8%  3dsvA  [x.x.x] GERANYLGERANYL TRANSFERASE TYPE-2 SUBUNIT ALPHA
    6e-06  16%  3cv0A  [x.x.x] PEROXISOME TARGETING SIGNAL 1 RECEPTOR PEX5
    6e-06  10%  2e0zC  [x.x.x] VIRUS-LIKE PARTICLE
    8e-06   7%  1dceA  [a.118.6 - b.7.4 - c.10.2] PROTEIN (RAB
    8e-06   6%  2c08A  [x.x.x] SH3-CONTAINING GRB2-LIKE PROTEIN 2
    8e-06  19%  3cvnA  [x.x.x] PEROXISOME TARGETING SIGNAL 1 RECEPTOR
    8e-06   6%  3ck7D  [x.x.x] SUSD
    1e-05   7%  3dsxA  [x.x.x] GERANYLGERANYL TRANSFERASE TYPE-2 SUBUNIT ALPHA
    1e-05  16%  3cvqA  [x.x.x] PEROXISOME TARGETING SIGNAL 1 RECEPTOR PEX5
    1e-05  17%  2bugA  [x.x.x] SERINE/THREONINE PROTEIN PHOSPHATASE 5
    1e-05   5%  3dssA  [x.x.x] GERANYLGERANYL TRANSFERASE TYPE-2 SUBUNIT ALPHA
    1e-05  13%  2e2eA  [x.x.x] FORMATE-DEPENDENT NITRITE REDUCTASE COMPLEX NRFG
    2e-05  19%  3cvpA  [x.x.x] PEROXISOME TARGETING SIGNAL 1 RECEPTOR PEX5
    2e-05  16%  1e96B  [a.118.8] NEUTROPHIL CYTOSOL FACTOR 2 (NCF-2) TPR DOMAIN,
    3e-05   7%  3c72A  [x.x.x] GERANYLGERANYL TRANSFERASE TYPE-2 SUBUNIT ALPHA
    7e-05  12%  2btpA  [x.x.x] 14-3-3 PROTEIN TAU
    8e-05   6%  2aw6B  [x.x.x] PRGX
    8e-05  10%  3e6yA  [x.x.x] 14-3-3-LIKE PROTEIN C
    1e-04   7%  2axvB  [x.x.x] PRGX
    1e-04   5%  2axvA  [x.x.x] PRGX
    1e-04  20%  1b89A  [a.118.1] PROTEIN (CLATHRIN HEAVY CHAIN)
    1e-04   5%  3dsuA  [x.x.x] GERANYLGERANYL TRANSFERASE TYPE-2 SUBUNIT ALPHA
    2e-04  12%  1a38A  [a.118.7] 14-3-3 PROTEIN ZETA
    3e-04  10%  2b05A  [x.x.x] 14-3-3 PROTEIN GAMMA
    4e-04  10%  2axuE  [x.x.x] PRGX
    4e-04  10%  2axuL  [x.x.x] PRGX
    5e-04  23%  3e4bD  [x.x.x] ALGK
    5e-04   9%  3draA  [x.x.x] PROTEIN
    6e-04  26%  2cptA  [x.x.x] VACUOLAR SORTING PROTEIN 4B
    7e-04   8%  2axuG  [x.x.x] PRGX
    7e-04   5%  3ee7D  [x.x.x] REPLICASE POLYPROTEIN 1A
    7e-04  12%  2bq0B  [x.x.x] 14-3-3 BETA/ALPHA
    8e-04   6%  2axzB  [x.x.x] PRGX
    9e-04  11%  2awiC  [x.x.x] PRGX
:116

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MSNFSKGNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALELYQDSKYF
2cg3A           ---LEQARASYARGEYRWVVEVVNRLVFAEPDNRAARELQADALEQLGYQAENAGWRNSYLSAAELRHGV
2cg2A           ------YYDGNPATLDPLSPEDSAGRYVEYMGGAERLLEQARASYARGEYRWVVEVVNRLVFAEDNRAAR
2cfuA           ------ARASYARGEYRWVVEVVNRLVFAEPDNRAARELQADALEQLGYQAENAGWRNSYLSAAELRHGV
2c0mA           ---CGLGVLFNLSGEYDKAVDCFTAALSVRPNDYLLWNKLGATLANGNQSEEAVAAYRRALELQGYIRSR
2cfzA           ---LEQARASYARGEYRWVVEVVNRLVFAEPDNRAARELQADALEQLGYQAENAGWRNSYLSAAELRHGV
3beeA           ---------YLHKQATDEVSLLLEQALQLEPYNEAALSLIANDHFISFRFQEAIDTWVLLLDSNPNLDRV
2dl1A           ---------------GSSGEPAEIKIIREAYKKAFLFVNKGLNTDELGQKEEAKNYYKQGIGH--LLRGI
2bedA           ---RDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELAANYTVW
3beeB           ---------YLHKQATDEVSLLLEQALQLEPYNEAALSLIANDHFISFRFQEAIDTWVLLLDSNPNLDRV
2crbA           ----------------------GSSGMEGPLNLAHQQSRRADRLLAAGKYEEAISCHRKATTYLSEAMKL
3dswA           ------FQKRQAGELDESVLELTSQILGANPDFATLWNCRREVLQHLETEKSPEESAALVKAELGFLESC
3dstA           ------------------KRLEREQKLKLYQ---SATQAVFQKRQAGELDESVLELTSQILGANDFATLW
1a37A           ------VLSLLEKFLIPNAAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKIRGLA
3cvlA           -----LGATLANGNRPQEALDAYNRALDINPGYVRVMYNMAVSYSNMSQYDLAAKQLVRAIYMQVGRSMW
3c3oA           ------MLAQAQEVFFLKATRDKMKDAIIAKLANQAADYFGDAFKQCQYKDTLPKEVFPVLAAIMQANAE
3ckbB           LPIRQDGVKTRNYGGSTYLVCGTRVAGMPRMGTTNGWSCIFARAAMVQKFFSNLEDVPMLPADVIPTKGL
2avpA           ---YNLGNAYYKQGDYDEAIEYYQKALELDPRSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPRS---
2dbaA           ---RKEGNELFKCGDYGGALAAYTQALGLDATPQDLHRNRAACHLKLEDYDKAETEASKAIEKDGDVKAL
2d4cD           ---AKLSMYPQAEALLAEAMLKFGRELGDDCNFGPALGEVGEAMRELSEVKDSLDIEVKQNFIDPQNLHD
3edtH           ------ASCYLKQGKYQDAETLYKEILTRAHEKEFGSGDNKPIWMHAEEREESKDKRRDACKVPTVNTTL
3e4bA           ------RRGYLGKVYPQKALDHLLTAAGQNSADFAIAQLFSQGKGTKPDPLNAYVFSQLAKAQDPEANDL
3dsvA           ------ELSVEKSTVLQSELESCKELQELEPENKWCIILLMRALDPLLYEKETLQYFSTLKAVDMRAAYL
3cv0A           --------------HMLQNNTDYPFEANNPYMYHENPMEEGLSMLKLNLAEAALAFEAVCQAAPEREEAW
2e0zC           ------KMKLSSWDNPEEALNDLMNALQEASNASAGPFGLIINPKRYAKLLKIVEVLKEIFRGVTLNIDE
1dceA           ------LKVKTSEEQAEAKRLEREQKLKLYQSATQAVFQKRQAG---ELDESVLELTSQILGANDFATLW
2c08A           ------GTKLDDDFKEERKVDVTSRAVEITKTIEYLQPNPARAKPQAEALLAEALKFGRELGDCNFGPAL
3cvnA           ------DYPFEANNPYMYHENPMEEGLSAFEAVCQAWRSLGLTQAENEKDGLAIIALNHARMLDPKDAVH
3ck7D           ------PTDECLWAWQKNQDIPQLTSISWSPSSQRTEWVYVRLGYDITQYNFFLDQTEGMTDAEQRAEIR
3dsxA           --------------SELESCKELQELEPENKWCLLTIILLMRALDPLLYEKETLQYFSTLKAVDMRAAYL
3cvqA           -----EGLSMLKLANLAEAALAFEAVCQKEPEREEAWRSLGLTQAENEKDGLAIIALNHARALDPAIAVH
2bugA           -----QANDYFKAKDYENAIKFYSQAIELNPSNAIYYGNRSLAYLRTECYGYALNDATRIELDKKYIKGY
3dssA           ------FQKRQAGELDESVLELTSQILGANPDFATLWNCRREVLQHLETEKSPEESAALVKAELGFLESC
2e2eA           ---------QASQHMTAQTRAMIDKALALDSNEITALMLLASDAFMQANYAQAIELWQKVMDLNPRINRT
3cvpA           ------DYPFEANNPYMYHENPMEEGLSAFEAVCQAWRSLGLTQAENEKDGLAIIALNHARMLDPKDAVH
1e96B           -----EGVLAADKKDWKGALDAFSAVQDPH---SRICFNIGCMYTILKNMTEAEKAFTRSINRDHLAVAY
3c72A           ---GRCELSVEKSTVLQSELESCKELQEENKWCLLTIILLMRALDPLLYEKETLQYFSTLKAVDMRAAYL
2btpA           ------------------NPESKVFYLKMKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKGLAL
2aw6B           ---LTISIMNRNLKEAQYYINQFEHLKTNGYYDLEINYLKQIYQFLTDKNIDSYLNAVNIINIFKIIGKE
3e6yA           --------------PSAASGDSKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLTAYKAAQDIATTGLAL
2axvB           -------KEAQYYINQFEHLKTIKNISINGYYDLEINYLKQIYQFLTDKNIDSYLNAVNIINIFKIHRSL
2axvA           ---------------QFEHLKTIKNISINGYYDLEINYLKQIYQFLTDKNIDSYLNAVNIINIFKIIGKL
1b89A           ---LAELEEFINGPMYDAAKLLYNNVSN--------FGRLASTLVHLGEYQAAVDGARKA----------
3dsuA           ---QAVFQKRQAGELDESVLELTSQILGANPDFATLWNCRREVLQHLETEKSPEESAALVKAELGFLESC
1a38A           ---------------------SKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKGLAL
2b05A           -------------DGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESKVFYLKYRYL
2axuE           -----KQIYQFLTDKNIDSYLNAVNIINGKEDIHRSLVEELTKISAKEKFTPPKEVTMYYENY-------
2axuL           EINYLKQIYQFLTDKNIDSYLNAVNIINIFKIIGKSLVEELTKISAKEKFTPPKEVTMYYEN--------
3e4bD           ------------PADAKAAEAHFEKAVGRE-VAAD--YYLGQIYRRKVYPQKALDHLLTAARNGQNSAD-
3draA           ------------TPVDINTEEPQICQILYDEDYKQIMGLLLALMKAEEYSERALHITELGINSHYTIWIY
2cptA           -----KAAQEDKAGNYEEALQLYQHAVQQGDKAKQSIRAKCTEYLDLKEYLK------------------
2axuG           ISINRNLKEAQYYINQFEHLKTIKNISINGYYDLEINYLKQIYQFLTDKNIDSYLNAVNIINIFKIHRSL
3ee7D           ------------------------------------MSCAAGTTQTACTDDNALAYYNNSKGRFVLALLH
2bq0B           ---SEVASGDNKQTTVSNSQQAYQEAFEISKKEMQALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDT
2axzB           ------ISINRNLKEAQYYINQFEHLKTIGYYDLEINYLKQIYQFLTDKNIDSYLNAVNIINIFKIRSLV
2awiC           EINYLKQIYQFLTDKNIDSYLNAVNIINGKEDIHRSLVEELTKISAKEKFTPPKEVTMYYE---------


                         .         .         *         .         .         .         .:140
query           FNLAYCYSMINNNSKALRYFNLAWALDNADIDCEKAISLILSKISK
2cg3A           PRDQGSADALAADTGLLFDYLGVRLDAGAAEGK-------------
2cg2A           ELQADALEQLGYQAENAGWRNSYLSAAYELRHGVPRDGSADAL---
2cfuA           PRDQGSADALAAMDTGLLFDYLGVRLDAGAAEG-------------
2c0mA           YNLGISCINLGAHREAVEHFLEALNMQRKSRGPRGEGGAMSENI--
2cfzA           PRDQGSADALAAMDTGLLFDYLGVRLDAGAAE--------------
3beeA           TIIESIN---------------------------------------
2dl1A           SISSKESEHTGPGWESARQMQQKMKET-------------------
2bedA           HFRRVLLRSLQKDLQEEMNYITAIIEEQPK----------------
3beeB           TIIESIN---------------------------------------
2crbA           TESEQAHLSLELQRDSHMKQLLLIQERWKRAKREERL---------
3dswA           LRVNPKSYGTWHHRCWLLSRLPEPNWARELELCARFLEA-------
3dstA           NCRREVLQHLETEKSPEESAALVKAELGFLESC-------------
1a37A           LNFSVFYYACSLAKTAFD----------------------------
3cvlA           DFFRMLLNVMNRPDLVELTYAQNVEPFAKEFG--------------
3c3oA           YHQSILAKQQKKFGEEIARLQHAAELIKTVASRYDEYVNVKDF---
3ckbB           DTDEQIDAFDAEHGIRTEDMIKAAGDDRALLYS-------------
2avpA           ----------------------------------------------
2dbaA           YRRSQALEKLGRLDQAVLDLQRCVSLEPKNKVFQEALRNISGPSS-
2d4cD           KDLREIQSALQHHLKKLEGRRLDFDIPDEELRQ-------------
3edtH           RSLGALYRRQGKLEAAHTLEDCA-----------------------
3e4bA           ATQLEAPLTPAQRAEGQRLVQQELAARGTL----------------
3dsvA           DDLRSKFLLENSVLKM------------------------------
3cv0A           RSLGLTQAENEKDGLAIIALNHARMLDPKDIAVHAALAVSHTN---
2e0zC           NKVIIFANTPAVLDVVVGQDVTLQELGPEG----------------
1dceA           NCRREVLQHLETEKSPEESAALVKAELGFLESC-------------
2c08A           GEVGEARELSEVKDSLDEVKQNFIDPLQNLHDK-------------
3cvnA           AALAVSHTNEHNANAALASLR-AWLLSQPQYEQ-------------
3ck7D           FLRALHYWYFLDLFGKAPFKEHFSNDLPVEKKGTELYTYIQNEL--
3dsxA           DDLRSKFLLENSVLKM------------------------------
3cvqA           AALAVSHTNEHNANAAL-----------------------------
2bugA           YRRAASNMALGKFRAALRDYETVVKVKPHDKDAKMKYQECNKIVKQ
3dssA           LRVNPKSYGTWHHRCWLLSRLPEPNWARELELCARFLEA-------
2e2eA           QLVESINMAKLLQRRSD-----------------------------
3cvpA           AALAVSHTNEHNANAAL-----------------------------
1e96B           FQRGMLYYQTEKYDLAIKDLKEALIQLR------------------
3c72A           DDLRSKFLLENSVLKM------------------------------
2btpA           NFSVFYYEILNNPELACTLAKTAFDEAIAELDTLNEDSYKDS----
2aw6B           DIHRSLVEELTK----------------------------------
3e6yA           NFSVFYYEILNSPDRACNLAKQAFDEAIAELDT-------------
2axvB           VEELTKISAKEKFTPPKEVTMYY-----------------------
2axvA           VEELTKISAKEKFTPPKEVTMYY-----------------------
1b89A           ----------------------------------------------
3dsuA           LRVNPKSYGTWHHRCWLLSRLPEPNWARELELCARFLEA-------
1a38A           NFSVFYYEILNSPEKACSLAKTAFDEAIAESYKDSTLIMQL-----
2b05A           AEVATGEKRATVVESSEKAYSEAHEISKEHMQPTHPIRLGLA----
2axuE           ----------------------------------------------
2axuL           ----------------------------------------------
3e4bD           FAIAQLFSQGKDPLNAYVFSQLAKATPEAN----------------
3draA           RFNILKNLPNRNLYDELDWCEEIALDNEKNYQIWNYRQLII-----
2cptA           ----------------------------------------------
2axuG           VEELTKISAKEKFTPPKEVTMYY-----------------------
3ee7D           QDLKWARFPKSDGTGTIYTELEP-----------------------
2bq0B           LNEESYKDSTLIMQLLRDNLTLW-----------------------
2axzB           EELTKISAKEKFTPPKEVTYY-------------------------
2awiC           ----------------------------------------------