[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for cper0:BAB81632.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2bu8A.bssp"
#ERROR : Can't open dsspfile "2e0aA.bssp"
#ERROR : Can't open dsspfile "3d2rA.bssp"
#ERROR : Can't open dsspfile "3dgeA.bssp"
#ERROR : Can't open dsspfile "2bu2A.bssp"
#ERROR : Can't open dsspfile "3d2rB.bssp"
#ERROR : Can't open dsspfile "2bu6A.bssp"
#ERROR : Can't open dsspfile "2e0aB.bssp"
#ERROR : Can't open dsspfile "3crlA.bssp"
#ERROR : Can't open dsspfile "2btzA.bssp"
#ERROR : Can't open dsspfile "3d36B.bssp"
#ERROR : Can't open dsspfile "2c2aA.bssp"
#ERROR : Can't open dsspfile "3clqB.bssp"
#ERROR : Can't open dsspfile "3crkB.bssp"
#ERROR : Can't open dsspfile "3clqD.bssp"
#ERROR : Can't open dsspfile "1b3qA.bssp"
#ERROR : Can't open dsspfile "3crkA.bssp"
#ERROR : Can't open dsspfile "3clqA.bssp"
#ERROR : Can't open dsspfile "2avwB.bssp"
#ERROR : Can't open dsspfile "2bu7A.bssp"
#ERROR : Can't open dsspfile "1e51A.bssp"
#ERROR : Can't open dsspfile "2bu5A.bssp"
#ERROR : Can't open dsspfile "2avwA.bssp"
#ERROR : Can't open dsspfile "3crlB.bssp"
#ERROR : Can't open dsspfile "1b3qB.bssp"
#ERROR : Can't open dsspfile "2ch4B.bssp"
#ERROR : Can't open dsspfile "1bxdA.bssp"
#ERROR : Can't open dsspfile "3d36A.bssp"
#ERROR : Can't open dsspfile "2crkA.bssp"
#ERROR : Can't open dsspfile "3bh1D.bssp"
#ERROR : Can't open dsspfile "3ehjB.bssp"
#ERROR : Can't open dsspfile "2dvyF.bssp"
#ERROR : Can't open dsspfile "3cgzA.bssp"
#ERROR : Can't open dsspfile "3ckeD.bssp"
#ERROR : Can't open dsspfile "3bnyC.bssp"
#ERROR : Can't open dsspfile "2ch4A.bssp"
#ERROR : Can't open dsspfile "3bh1A.bssp"
#ERROR : Can't open dsspfile "3ehhB.bssp"
#ERROR : Can't open dsspfile "3ehfD.bssp"
#ERROR : Can't open dsspfile "2cw9A.bssp"
#ERROR : Can't open dsspfile "3b2mB.bssp"
#ERROR : Can't open dsspfile "3ehhA.bssp"
#ERROR : Can't open dsspfile "1aj6A.bssp"
#ERROR : Can't open dsspfile "2ccsA.bssp"
#ERROR : Can't open dsspfile "2de0X.bssp"
#ERROR : Can't open dsspfile "1ah6A.bssp"
#ERROR : Can't open dsspfile "3ehfA.bssp"
#ERROR : Can't open dsspfile "3cgzB.bssp"
#ERROR : Can't open dsspfile "2cgfA.bssp"
#ERROR : Can't open dsspfile "1b63A.bssp"
#ERROR : Can't open dsspfile "3b2mC.bssp"
#ERROR : Can't open dsspfile "2dvyD.bssp"
#ERROR : Can't open dsspfile "3bnxA.bssp"
#ERROR : Can't open dsspfile "1eh8A.bssp"
#ERROR : Can't open dsspfile "1e51B.bssp"
#ERROR : Can't open dsspfile "1ah8A.bssp"
#ERROR : Can't open dsspfile "3c11A.bssp"
#ERROR : Can't open dsspfile "3bmyA.bssp"
#ERROR : Can't open dsspfile "2cg9B.bssp"
#ERROR : Can't open dsspfile "3cwvA.bssp"
#ERROR : Can't open dsspfile "3bp9Y.bssp"
#ERROR : Can't open dsspfile "2dvyC.bssp"
#ERROR : Can't open dsspfile "1csgA.bssp"
#ERROR : Can't open dsspfile "2akpB.bssp"
#ERROR : Can't open dsspfile "3c0eA.bssp"
#ERROR : Can't open dsspfile "2dvyA.bssp"
#ERROR : Can't open dsspfile "3cgyC.bssp"
#ERROR : Can't open dsspfile "1ah8B.bssp"
#ERROR : Can't open dsspfile "3ehgA.bssp"
#ERROR : Can't open dsspfile "2byhA.bssp"
#ERROR : Can't open dsspfile "1byqA.bssp"
#ERROR : Can't open dsspfile "3ckeB.bssp"
#ERROR : Can't open dsspfile "3c2wB.bssp"
#ERROR : Can't open dsspfile "2breA.bssp"
#ERROR : Can't open dsspfile "1b62A.bssp"
#ERROR : Can't open dsspfile "3bjeA.bssp"
#ERROR : Can't open dsspfile "3c2wA.bssp"
#ERROR : Can't open dsspfile "3c2wF.bssp"
#ERROR : Can't open dsspfile "2c13B.bssp"
#ERROR : Can't open dsspfile "2bz5A.bssp"
#ERROR : Can't open dsspfile "2cg9A.bssp"
#ERROR : Can't open dsspfile "2akpA.bssp"
#ERROR : Can't open dsspfile "2cwoA.bssp"
#ERROR : Can't open dsspfile "3cgyA.bssp"
#ERROR : Can't open dsspfile "3dt4C.bssp"
#ERROR : Can't open dsspfile "3c2wE.bssp"
#ERROR : Can't open dsspfile "3cgyB.bssp"
#ERROR : Can't open dsspfile "3bulA.bssp"
#ERROR : Can't open dsspfile "1bknA.bssp"
#ERROR : Can't open dsspfile "1ei1A.bssp"
#ERROR : Can't open dsspfile "1ea6B.bssp"
#ERROR : Can't open dsspfile "2dvyB.bssp"
#ERROR : Can't open dsspfile "3bnyB.bssp"
#ERROR : Can't open dsspfile "1bdtA.bssp"
#ERROR : Can't open dsspfile "3ehjA.bssp"
#ERROR : Can't open dsspfile "2aswA.bssp"
#ERROR : Can't open dsspfile "1ea6A.bssp"
#ERROR : Can't open dsspfile "1bknB.bssp"
#ERROR : Can't open dsspfile "2brcA.bssp"
#ERROR : Can't open dsspfile "1bmtA.bssp"
#ERROR : Can't open dsspfile "2c13A.bssp"
#ERROR : Can't open dsspfile "3c2eA.bssp"

## Summary of PDB Search
:507
    8e-31  15%  2bu8A  [x.x.x] PYRUVATE DEHYDROGENASE KINASE ISOENZYME 2
    2e-30  14%  2e0aA  [x.x.x] PYRUVATE DEHYDROGENASE KINASE ISOZYME 4
    1e-29  12%  3d2rA  [x.x.x] [PYRUVATE DEHYDROGENASE [LIPOAMIDE]] KINASE
    2e-29  29%  3dgeA  [x.x.x] SENSOR PROTEIN
    2e-29  10%  2bu2A  [x.x.x] PYRUVATE DEHYDROGENSAE KINASE ISOENZYME 2
    7e-29  13%  3d2rB  [x.x.x] [PYRUVATE DEHYDROGENASE [LIPOAMIDE]] KINASE
    1e-28  10%  2bu6A  [x.x.x] PYRUVATE DEHYDROGENASE KINASE ISOENZYME 2
    6e-27  13%  2e0aB  [x.x.x] PYRUVATE DEHYDROGENASE KINASE ISOZYME 4
    2e-25  12%  3crlA  [x.x.x] PYRUVATE DEHYDROGENASE [LIPOAMIDE] KINASE
    3e-25  13%  2btzA  [x.x.x] PYRUVATE DEHYDROGENASE KINASE ISOENZYME 2
    2e-24  17%  3d36B  [x.x.x] SPORULATION KINASE B
    2e-24  29%  2c2aA  [x.x.x] SENSOR HISTIDINE KINASE
    4e-24   7%  3clqB  [x.x.x] UNCHARACTERIZED PROTEIN
    2e-23  12%  3crkB  [x.x.x] PYRUVATE DEHYDROGENASE [LIPOAMIDE] KINASE
    3e-23   8%  3clqD  [x.x.x] UNCHARACTERIZED PROTEIN
    6e-23  15%  1b3qA  [a.30.2 - d.122.1 - b.40.7] PROTEIN (CHEMOTAXIS PROTEIN CHEA)
    1e-22  11%  3crkA  [x.x.x] PYRUVATE DEHYDROGENASE [LIPOAMIDE] KINASE
    1e-22   7%  3clqA  [x.x.x] UNCHARACTERIZED PROTEIN
    2e-22   8%  2avwB  [x.x.x] IGG-DEGRADING PROTEASE
    4e-22  11%  2bu7A  [x.x.x] PYRUVATE DEHYDROGENASE KINASE ISOENZYME 2
    5e-22   9%  1e51A  [c.1.10] DELTA-AMINOLEVULINIC ACID DEHYDRATASE
    3e-21  11%  2bu5A  [x.x.x] PYRUVATE DEHYDROGENASE KINASE ISOENZYME 2
    4e-20   7%  2avwA  [x.x.x] IGG-DEGRADING PROTEASE
    6e-20  11%  3crlB  [x.x.x] PYRUVATE DEHYDROGENASE [LIPOAMIDE] KINASE
    2e-19  13%  1b3qB  [a.30.2 - d.122.1 - b.40.7] PROTEIN (CHEMOTAXIS PROTEIN CHEA)
    3e-19  14%  2ch4B  [x.x.x] CHEMOTAXIS PROTEIN CHEA
    8e-19  21%  1bxdA  [d.122.1] PROTEIN (OSMOLARITY SENSOR PROTEIN (ENVZ))
    1e-18  17%  3d36A  [x.x.x] SPORULATION KINASE B
    1e-18   9%  2crkA  [a.83.1 - d.128.1] PROTEIN (CREATINE KINASE)
    2e-18  10%  3bh1D  [x.x.x] UPF0371 PROTEIN DIP2346
    2e-18   9%  3ehjB  [x.x.x] SENSOR KINASE (YOCF PROTEIN)
    2e-18  14%  2dvyF  [x.x.x] RESTRICTION ENDONUCLEASE PABI
    4e-18  13%  3cgzA  [x.x.x] VIRULENCE SENSOR HISTIDINE KINASE PHOQ
    1e-17  11%  3ckeD  [x.x.x] ARISTOLOCHENE SYNTHASE
    2e-17   9%  3bnyC  [x.x.x] ARISTOLOCHENE SYNTHASE
    2e-17  10%  2ch4A  [x.x.x] CHEMOTAXIS PROTEIN CHEA
    5e-17  10%  3bh1A  [x.x.x] UPF0371 PROTEIN DIP2346
    6e-16  11%  3ehhB  [x.x.x] SENSOR KINASE (YOCF PROTEIN)
    3e-15  12%  3ehfD  [x.x.x] SENSOR KINASE (YOCF PROTEIN)
    4e-15  10%  2cw9A  [x.x.x] TRANSLOCASE OF INNER MITOCHONDRIAL MEMBRANE
    7e-15  12%  3b2mB  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN SPY0128
    8e-15  12%  3ehhA  [x.x.x] SENSOR KINASE (YOCF PROTEIN)
    1e-14  15%  1aj6A  [x.x.x] GYRASE
    2e-14   9%  2ccsA  [x.x.x] HEAT SHOCK PROTEIN HSP-90 ALPHA
    7e-14  10%  2de0X  [x.x.x] ALPHA-(1,6)-FUCOSYLTRANSFERASE
    8e-14   9%  1ah6A  [x.x.x] HEAT SHOCK PROTEIN 90
    9e-14  12%  3ehfA  [x.x.x] SENSOR KINASE (YOCF PROTEIN)
    1e-13  13%  3cgzB  [x.x.x] VIRULENCE SENSOR HISTIDINE KINASE PHOQ
    1e-13   9%  2cgfA  [x.x.x] ATP-DEPENDENT MOLECULAR CHAPERONE HSP82
    1e-13  14%  1b63A  [d.122.1 - d.14.1] MUTL
    2e-13  11%  3b2mC  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN SPY0128
    2e-13  15%  2dvyD  [x.x.x] RESTRICTION ENDONUCLEASE PABI
    3e-13  11%  3bnxA  [x.x.x] ARISTOLOCHENE SYNTHASE
    3e-13  11%  1eh8A  [c.55.7 - a.4.2] O6-ALKYLGUANINE-DNA ALKYLTRANSFERASE
    4e-13  10%  1e51B  [c.1.10] DELTA-AMINOLEVULINIC ACID DEHYDRATASE
    4e-13   8%  1ah8A  [d.122.1] HEAT SHOCK PROTEIN 90
    7e-13   9%  3c11A  [x.x.x] ATP-DEPENDENT MOLECULAR CHAPERONE HSP82
    7e-13  12%  3bmyA  [x.x.x] HEAT SHOCK PROTEIN HSP 90-ALPHA
    1e-12   8%  2cg9B  [x.x.x] ATP-DEPENDENT MOLECULAR CHAPERONE HSP82
    1e-12   6%  3cwvA  [x.x.x] DNA GYRASE, B SUBUNIT, TRUNCATED
    2e-12  10%  3bp9Y  [x.x.x] GAG PROTEIN
    3e-12  17%  2dvyC  [x.x.x] RESTRICTION ENDONUCLEASE PABI
    3e-12   9%  1csgA  [a.26.1] GRANULOCYTE COLONY-STIMULATING FACTOR RECEPTOR
    5e-12   8%  2akpB  [x.x.x] ATP-DEPENDENT MOLECULAR CHAPERONE HSP82
    6e-12  10%  3c0eA  [x.x.x] ATP-DEPENDENT MOLECULAR CHAPERONE HSP82
    8e-12  16%  2dvyA  [x.x.x] RESTRICTION ENDONUCLEASE PABI
    1e-11  15%  3cgyC  [x.x.x] VIRULENCE SENSOR HISTIDINE KINASE PHOQ
    1e-11   9%  1ah8B  [d.122.1] HEAT SHOCK PROTEIN 90
    1e-11  12%  3ehgA  [x.x.x] SENSOR KINASE (YOCF PROTEIN)
    2e-11  10%  2byhA  [x.x.x] HEAT SHOCK PROTEIN HSP90-ALPHA
    2e-11  10%  1byqA  [d.122.1] PROTEIN (HEAT SHOCK PROTEIN 90)
    2e-11   8%  3ckeB  [x.x.x] ARISTOLOCHENE SYNTHASE
    2e-11   6%  3c2wB  [x.x.x] BACTERIOPHYTOCHROME
    3e-11   9%  2breA  [x.x.x] ATP-DEPENDENT MOLECULAR CHAPERONE HSP82
    4e-11  14%  1b62A  [d.122.1 - d.14.1] PROTEIN (MUTL)
    4e-11  10%  3bjeA  [x.x.x] NUCLEOSIDE PHOSPHORYLASE, PUTATIVE
    6e-11   8%  3c2wA  [x.x.x] BACTERIOPHYTOCHROME
    8e-11   8%  3c2wF  [x.x.x] BACTERIOPHYTOCHROME
    1e-10  11%  2c13B  [x.x.x] DELTA-AMINOLEVULINIC ACID DEHYDRATASE
    2e-10  10%  2bz5A  [x.x.x] HEAT SHOCK PROTEIN HSP90-ALPHA
    9e-10   9%  2cg9A  [x.x.x] ATP-DEPENDENT MOLECULAR CHAPERONE HSP82
    1e-09   6%  2akpA  [x.x.x] ATP-DEPENDENT MOLECULAR CHAPERONE HSP82
    1e-09  12%  2cwoA  [x.x.x] RNA SILENCING SUPPRESSOR
    2e-09  10%  3cgyA  [x.x.x] VIRULENCE SENSOR HISTIDINE KINASE PHOQ
    4e-09  15%  3dt4C  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    8e-09   7%  3c2wE  [x.x.x] BACTERIOPHYTOCHROME
    1e-08  10%  3cgyB  [x.x.x] VIRULENCE SENSOR HISTIDINE KINASE PHOQ
    2e-08   8%  3bulA  [x.x.x] METHIONINE SYNTHASE
    2e-08  14%  1bknA  [d.122.1 - d.14.1] MUTL
    3e-08  13%  1ei1A  [d.122.1 - d.14.1] DNA GYRASE B
    3e-08   6%  1ea6B  [d.122.1 - d.14.1] PMS1 PROTEIN HOMOLOG 2
    7e-08  16%  2dvyB  [x.x.x] RESTRICTION ENDONUCLEASE PABI
    7e-08   8%  3bnyB  [x.x.x] ARISTOLOCHENE SYNTHASE
    1e-07  12%  1bdtA  [a.43.1] PROTEIN (GENE-REGULATING PROTEIN ARC)
    2e-07  15%  3ehjA  [x.x.x] SENSOR KINASE (YOCF PROTEIN)
    5e-07  31%  2aswA  [x.x.x] HYPOTHETICAL PROTEIN AF1503
    2e-06  10%  1ea6A  [d.122.1 - d.14.1] PMS1 PROTEIN HOMOLOG 2
    2e-06  16%  1bknB  [d.122.1 - d.14.1] MUTL
    3e-06   5%  2brcA  [x.x.x] ATP-DEPENDENT MOLECULAR CHAPERONE HSP82
    5e-05   5%  1bmtA  [a.46.1 - c.23.6] METHIONINE SYNTHASE
    1e-04  10%  2c13A  [x.x.x] DELTA-AMINOLEVULINIC ACID DEHYDRATASE
    5e-04   5%  3c2eA  [x.x.x] NICOTINATE-NUCLEOTIDE PYROPHOSPHORYLASE
:507

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bu8A           ----------------------------------------------------------------------
2e0aA           ----------------------------------------------------------------------
3d2rA           ----------------------------------------------------------------------
3dgeA           ----------------------------------------------------------------------
2bu2A           ----------------------------------------------------------------------
3d2rB           ----------------------------------------------------------------------
2bu6A           ----------------------------------------------------------------------
2e0aB           ----------------------------------------------------------------------
3crlA           ----------------------------------------------------------------------
2btzA           ----------------------------------------------------------------------
3d36B           ----------------------------------------------------------------------
2c2aA           ----------------------------------------------------------------------
3clqB           ----------------------------------------------------------------------
3crkB           ----------------------------------------------------------------------
3clqD           ----------------------------------------------------------------------
1b3qA           ----------------------------------------------------------------------
3crkA           ----------------------------------------------------------------------
3clqA           ----------------------------------------------------------------------
2avwB           ----------------------------------------------------------------------
2bu7A           ----------------------------------------------------------------------
1e51A           ----------------------------------------------------------------------
2bu5A           ----------------------------------------------------------------------
2avwA           ----------------------------------------------------------------------
3crlB           ----------------------------------------------------------------------
1b3qB           ----------------------------------------------------------------------
2ch4B           ----------------------------------------------------------------------
1bxdA           ----------------------------------------------------------------------
3d36A           ----------------------------------------------------------------------
2crkA           ----------------------------------------------------------------------
3bh1D           ----------------------------------------------------------------------
3ehjB           ----------------------------------------------------------------------
2dvyF           ----------------------------------------------------------------------
3cgzA           ----------------------------------------------------------------------
3ckeD           ----------------------------------------------------------------------
3bnyC           ----------------------------------------------------------------------
2ch4A           ----------------------------------------------------------------------
3bh1A           ----------------------------------------------------------------------
3ehhB           ----------------------------------------------------------------------
3ehfD           ----------------------------------------------------------------------
2cw9A           ----------------------------------------------------------------------
3b2mB           ----------------------------------------------------------------------
3ehhA           ----------------------------------------------------------------------
1aj6A           ----------------------------------------------------------------------
2ccsA           ----------------------------------------------------------------------
2de0X           ----------------------------------------------------------------------
1ah6A           ----------------------------------------------------------------------
3ehfA           ----------------------------------------------------------------------
3cgzB           ----------------------------------------------------------------------
2cgfA           ----------------------------------------------------------------------
1b63A           ----------------------------------------------------------------------
3b2mC           ----------------------------------------------------------------------
2dvyD           ----------------------------------------------------------------------
3bnxA           ----------------------------------------------------------------------
1eh8A           ----------------------------------------------------------------------
1e51B           ----------------------------------------------------------------------
1ah8A           ----------------------------------------------------------------------
3c11A           ----------------------------------------------------------------------
3bmyA           ----------------------------------------------------------------------
2cg9B           ----------------------------------------------------------------------
3cwvA           ----------------------------------------------------------------------
3bp9Y           ----------------------------------------------------------------------
2dvyC           ----------------------------------------------------------------------
1csgA           ----------------------------------------------------------------------
2akpB           ----------------------------------------------------------------------
3c0eA           ----------------------------------------------------------------------
2dvyA           ----------------------------------------------------------------------
3cgyC           ----------------------------------------------------------------------
1ah8B           ----------------------------------------------------------------------
3ehgA           ----------------------------------------------------------------------
2byhA           ----------------------------------------------------------------------
1byqA           ----------------------------------------------------------------------
3ckeB           ----------------------------------------------------------------------
3c2wB           ----------------------------------------------------------------------
2breA           ----------------------------------------------------------------------
1b62A           ----------------------------------------------------------------------
3bjeA           ----------------------------------------------------------------------
3c2wA           ----------------------------------------------------------------------
3c2wF           ----------------------------------------------------------------------
2c13B           ----------------------------------------------------------------------
2bz5A           ----------------------------------------------------------------------
2cg9A           ----------------------------------------------------------------------
2akpA           ----------------------------------------------------------------------
2cwoA           ----------------------------------------------------------------------
3cgyA           ----------------------------------------------------------------------
3dt4C           ----------------------------------------------------------------------
3c2wE           ----------------------------------------------------------------------
3cgyB           ----------------------------------------------------------------------
3bulA           ----------------------------------------------------------------------
1bknA           ----------------------------------------------------------------------
1ei1A           ----------------------------------------------------------------------
1ea6B           ----------------------------------------------------------------------
2dvyB           ----------------------------------------------------------------------
3bnyB           ----------------------------------------------------------------------
1bdtA           ----------------------------------------------------------------------
3ehjA           ----------------------------------------------------------------------
2aswA           ----------------------------------------------------------------------
1ea6A           ----------------------------------------------------------------------
1bknB           ----------------------------------------------------------------------
2brcA           ----------------------------------------------------------------------
1bmtA           ----------------------------------------------------------------------
2c13A           ----------------------------------------------------------------------
3c2eA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bu8A           ----------------------------------------------------------------------
2e0aA           ----------------------------------------------------------------------
3d2rA           ----------------------------------------------------------------------
3dgeA           ----------------------------------------------------------------------
2bu2A           ----------------------------------------------------------------------
3d2rB           ----------------------------------------------------------------------
2bu6A           ----------------------------------------------------------------------
2e0aB           ----------------------------------------------------------------------
3crlA           ----------------------------------------------------------------------
2btzA           ----------------------------------------------------------------------
3d36B           ----------------------------------------------------------------------
2c2aA           ----------------------------------------------------------------------
3clqB           ----------------------------------------------------------------------
3crkB           ----------------------------------------------------------------------
3clqD           ----------------------------------------------------------------------
1b3qA           ----------------------------------------------------------------------
3crkA           ----------------------------------------------------------------------
3clqA           ----------------------------------------------------------------------
2avwB           ----------------------------------------------------------------------
2bu7A           ----------------------------------------------------------------------
1e51A           ----------------------------------------------------------------------
2bu5A           ----------------------------------------------------------------------
2avwA           ----------------------------------------------------------------------
3crlB           ----------------------------------------------------------------------
1b3qB           ----------------------------------------------------------------------
2ch4B           ----------------------------------------------------------------------
1bxdA           ----------------------------------------------------------------------
3d36A           ----------------------------------------------------------------------
2crkA           ----------------------------------------------------------------------
3bh1D           ----------------------------------------------------------------------
3ehjB           ----------------------------------------------------------------------
2dvyF           ----------------------------------------------------------------------
3cgzA           ----------------------------------------------------------------------
3ckeD           ----------------------------------------------------------------------
3bnyC           ----------------------------------------------------------------------
2ch4A           ----------------------------------------------------------------------
3bh1A           ----------------------------------------------------------------------
3ehhB           ----------------------------------------------------------------------
3ehfD           ----------------------------------------------------------------------
2cw9A           ----------------------------------------------------------------------
3b2mB           ----------------------------------------------------------------------
3ehhA           ----------------------------------------------------------------------
1aj6A           ----------------------------------------------------------------------
2ccsA           ----------------------------------------------------------------------
2de0X           ----------------------------------------------------------------------
1ah6A           ----------------------------------------------------------------------
3ehfA           ----------------------------------------------------------------------
3cgzB           ----------------------------------------------------------------------
2cgfA           ----------------------------------------------------------------------
1b63A           ----------------------------------------------------------------------
3b2mC           ----------------------------------------------------------------------
2dvyD           ----------------------------------------------------------------------
3bnxA           ----------------------------------------------------------------------
1eh8A           ----------------------------------------------------------------------
1e51B           ----------------------------------------------------------------------
1ah8A           ----------------------------------------------------------------------
3c11A           ----------------------------------------------------------------------
3bmyA           ----------------------------------------------------------------------
2cg9B           ----------------------------------------------------------------------
3cwvA           ----------------------------------------------------------------------
3bp9Y           ----------------------------------------------------------------------
2dvyC           ----------------------------------------------------------------------
1csgA           ----------------------------------------------------------------------
2akpB           ----------------------------------------------------------------------
3c0eA           ----------------------------------------------------------------------
2dvyA           ----------------------------------------------------------------------
3cgyC           ----------------------------------------------------------------------
1ah8B           ----------------------------------------------------------------------
3ehgA           ----------------------------------------------------------------------
2byhA           ----------------------------------------------------------------------
1byqA           ----------------------------------------------------------------------
3ckeB           ----------------------------------------------------------------------
3c2wB           ----------------------------------------------------------------------
2breA           ----------------------------------------------------------------------
1b62A           ----------------------------------------------------------------------
3bjeA           ----------------------------------------------------------------------
3c2wA           ----------------------------------------------------------------------
3c2wF           ----------------------------------------------------------------------
2c13B           ----------------------------------------------------------------------
2bz5A           ----------------------------------------------------------------------
2cg9A           ----------------------------------------------------------------------
2akpA           ----------------------------------------------------------------------
2cwoA           ----------------------------------------------------------------------
3cgyA           ----------------------------------------------------------------------
3dt4C           ----------------------------------------------------------------------
3c2wE           ----------------------------------------------------------------------
3cgyB           ----------------------------------------------------------------------
3bulA           ----------------------------------------------------------------------
1bknA           ----------------------------------------------------------------------
1ei1A           ----------------------------------------------------------------------
1ea6B           ----------------------------------------------------------------------
2dvyB           ----------------------------------------------------------------------
3bnyB           ----------------------------------------------------------------------
1bdtA           ----------------------------------------------------------------------
3ehjA           ----------------------------------------------------------------------
2aswA           ----------------------------------------------------------------------
1ea6A           ----------------------------------------------------------------------
1bknB           ----------------------------------------------------------------------
2brcA           ----------------------------------------------------------------------
1bmtA           ----------------------------------------------------------------------
2c13A           ----------------------------------------------------------------------
3c2eA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxSNLISKPLVKLN
2bu8A           ----------------------------------------------------------------------
2e0aA           ----------------------------------------------------------------------
3d2rA           ----------------------------------------------------------------------
3dgeA           ----------------------------------------------------------------------
2bu2A           ----------------------------------------------------------------------
3d2rB           ----------------------------------------------------------------------
2bu6A           -------------------------------------------------------------LANIMKEIN
2e0aB           ----------------------------------------------------------------------
3crlA           ----------------------------------------------------------------------
2btzA           ----------------------------------------------------------------------
3d36B           ----------------------------------------------------------------------
2c2aA           ----------------------------------------------------------------------
3clqB           ----------------------------------------------------------------------
3crkB           ----------------------------------------------------------------------
3clqD           ----------------------------------------------------------------------
1b3qA           ----------------------------------------------------------------------
3crkA           ----------------------------------------------------------------------
3clqA           ----------------------------------------------------------------------
2avwB           ----------------------------------------------------------------------
2bu7A           ----------------------------------------------------------------------
1e51A           ----------------------------------------------------------------------
2bu5A           ----------------------------------------------------------------------
2avwA           ----------------------------------------------------------------------
3crlB           ----------------------------------------------------------------------
1b3qB           ----------------------------------------------------------------------
2ch4B           ----------------------------------------------------------------------
1bxdA           ----------------------------------------------------------------------
3d36A           ----------------------------------------------------------------------
2crkA           ----------------------------------------------------------------------
3bh1D           ----------------------------------------------------------------------
3ehjB           ----------------------------------------------------------------------
2dvyF           ----------------------------------------------------------------------
3cgzA           ----------------------------------------------------------------------
3ckeD           ----------------------------------------------------------------------
3bnyC           ----------------------------------------------------------------------
2ch4A           ----------------------------------------------------------------------
3bh1A           ----------------------------------------------------------------------
3ehhB           ----------------------------------------------------------------------
3ehfD           ----------------------------------------------------------------------
2cw9A           ----------------------------------------------------------------------
3b2mB           ----------------------------------------------------------------------
3ehhA           ----------------------------------------------------------------------
1aj6A           ----------------------------------------------------------------------
2ccsA           ----------------------------------------------------------------------
2de0X           ----------------------------------------------------------------------
1ah6A           ----------------------------------------------------------------------
3ehfA           ----------------------------------------------------------------------
3cgzB           ----------------------------------------------------------------------
2cgfA           ----------------------------------------------------------------------
1b63A           ----------------------------------------------------------------------
3b2mC           ----------------------------------------------------------------------
2dvyD           ----------------------------------------------------------------------
3bnxA           ----------------------------------------------------------------------
1eh8A           ----------------------------------------------------------------------
1e51B           ----------------------------------------------------------------------
1ah8A           ----------------------------------------------------------------------
3c11A           ----------------------------------------------------------------------
3bmyA           ----------------------------------------------------------------------
2cg9B           ----------------------------------------------------------------------
3cwvA           ----------------------------------------------------------------------
3bp9Y           ----------------------------------------------------------------PLRLGG
2dvyC           ----------------------------------------------------------------------
1csgA           ----------------------------------------------------------------------
2akpB           ----------------------------------------------------------------------
3c0eA           ----------------------------------------------------------------------
2dvyA           ----------------------------------------------------------------------
3cgyC           ----------------------------------------------------------------------
1ah8B           ----------------------------------------------------------------------
3ehgA           ----------------------------------------------------------------------
2byhA           ----------------------------------------------------------------------
1byqA           ----------------------------------------------------------------------
3ckeB           ----------------------------------------------------------------------
3c2wB           ----------------------------------------------------------------------
2breA           ----------------------------------------------------------------------
1b62A           ----------------------------------------------------------------------
3bjeA           ----------------------------------------------------------------------
3c2wA           ----------------------------------------------------------------------
3c2wF           ----------------------------------------------------------------------
2c13B           ----------------------------------------------------------------------
2bz5A           ----------------------------------------------------------------------
2cg9A           ----------------------------------------------------------------------
2akpA           ----------------------------------------------------------------------
2cwoA           ----------------------------------------------------------------------
3cgyA           ----------------------------------------------------------------------
3dt4C           ----------------------------------------------------------------------
3c2wE           ----------------------------------------------------------------------
3cgyB           ----------------------------------------------------------------------
3bulA           ----------------------------------------------------------------------
1bknA           ----------------------------------------------------------------------
1ei1A           ----------------------------------------------------------------------
1ea6B           ----------------------------------------------------------------------
2dvyB           ----------------------------------------------------------------------
3bnyB           ----------------------------------------------------------------------
1bdtA           ----------------------------------------------------------------------
3ehjA           ----------------------------------------------------------------------
2aswA           ----------------------------------------------------------SSTITRPIIELS
1ea6A           ----------------------------------------------------------------------
1bknB           ----------------------------------------------------------------------
2brcA           ----------------------------------------------------------------------
1bmtA           ----------------------------------------------------------------------
2c13A           ----------------------------------------------------------------------
3c2eA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           KSAKKMSAMDFSEKCDIEREDEIGNLAKTLNFLSKNLSNALDDLKIKNXXXXXXXXXXXXXXXXXXXFIA
2bu8A           -------------------------------------------------------------------YFL
2e0aA           -------------------------------------------------------------------FVD
3d2rA           -------------------------------------------------------------------FVD
3dgeA           -------------------------------------------------------------------FIA
2bu2A           -------------------------------------------------------------------ALV
3d2rB           ----------------QLVKSWYIQSLMDLVEFHEKSPDDQKALS---------------------DFVD
2bu6A           LLPDRVLSTPSVQLV-QSWYVQSLLDIMEFLDKDPEDHRTLSQFT---------------------DALV
2e0aB           -------------------------------------------------------------------FVD
3crlA           -------------------------------------------------------------------ALV
2btzA           ----------------------------------------------------------------------
3d36B           -------------------------------------------------------------------LAA
2c2aA           -------------------------------------------------------------------FIA
3clqB           -------------------------------------------------------------------ITF
3crkB           -------------------------------------------------------------------IRN
3clqD           -------------------------------------------------------------------ITF
1b3qA           ----------------------------------------------------------------------
3crkA           -------------------------------------------------------------------ALV
3clqA           -------------------------------------------------------------------ITF
2avwB           -------------------------------------------------------------------YDI
2bu7A           -------------------------------------------------------------------ALV
1e51A           ----------------------------------------------------------------------
2bu5A           -------------------------------------------------------------------ALV
2avwA           -------------------------------------------------------------------YDI
3crlB           -------------------------------------------------------------------ALV
1b3qB           ----------------------------------------------------------------------
2ch4B           ----------------------------------------------------------------------
1bxdA           ----------------------------------------------------------------------
3d36A           -------------------------------------------------------------------LAA
2crkA           ----------------YKSEEEYPDLSKHNNHMAKVLTPDLYKKIQTGVDNPGHPFIMTVGCVAGDEESY
3bh1D           ----------------------------------------------------------------------
3ehjB           -------------------------------------------------------------------QRA
2dvyF           ----------------------------------------------------------------------
3cgzA           ----------------------------------------------------------------------
3ckeD           -------------------------------------------------------------------MGL
3bnyC           ----------------------------------------------------------------------
2ch4A           ----------------------------------------------------------------------
3bh1A           ----------------------------------------------------------------------
3ehhB           -------------------------------------------------------------------QRA
3ehfD           -------------------------------------------------------------------IAR
2cw9A           -------------------------------------------------------------------FLK
3b2mB           ----------------------------------------------------------------------
3ehhA           -------------------------------------------------------------------QRA
1aj6A           ----------------------------------------------------------------------
2ccsA           ----------------------------------------------------------------------
2de0X           -------------------------------------------------------------------LRR
1ah6A           ----------------------------------------------------------------------
3ehfA           -------------------------------------------------------------------IAR
3cgzB           ----------------------------------------------------------------------
2cgfA           ----------------------------------------------------------------------
1b63A           ----------------------------------------------------------------------
3b2mC           ----------------------------------------------------------------------
2dvyD           ----------------------------------------------------------------------
3bnxA           ----------------------------------------------------------------------
1eh8A           ----------------------------------------------------------------------
1e51B           ----------------------------------------------------------------------
1ah8A           ----------------------------------------------------------------------
3c11A           ----------------------------------------------------------------------
3bmyA           ----------------------------------------------------------------------
2cg9B           ----------------------------------------------------------------------
3cwvA           ----------------------------------------------------------------------
3bp9Y           NGQL--QYWPFSSSDLYNWKNNNPSFSEDPGKLTALIESVLTTHQP---------------------TWD
2dvyC           ----------------------------------------------------------------------
1csgA           -------------------------------------------------------------------GLR
2akpB           ----------------------------------------------------------------------
3c0eA           ----------------------------------------------------------------------
2dvyA           ----------------------------------------------------------------------
3cgyC           ----------------------------------------------------------------------
1ah8B           ----------------------------------------------------------------------
3ehgA           ----------------------------------------------------------------------
2byhA           ----------------------------------------------------------------------
1byqA           ----------------------------------------------------------------------
3ckeB           ----------------------------------------------------------------------
3c2wB           -------------------------------------------------------------------ALA
2breA           ----------------------------------------------------------------------
1b62A           ----------------------------------------------------------------------
3bjeA           ----------------------------------------------------------------------
3c2wA           -------------------------------------------------------------------ALA
3c2wF           -------------------------------------------------------------------ALA
2c13B           ----------------------------------------------------------------------
2bz5A           ----------------------------------------------------------------------
2cg9A           ----------------------------------------------------------------------
2akpA           ----------------------------------------------------------------------
2cwoA           -------------------------------------------------------------------HRE
3cgyA           ----------------------------------------------------------------------
3dt4C           ----------------------------------------------------------------------
3c2wE           -------------------------------------------------------------------ALA
3cgyB           ----------------------------------------------------------------------
3bulA           ----------------------------------------------------------------------
1bknA           ----------------------------------------------------------------------
1ei1A           ----------------------------------------------------------------------
1ea6B           ----------------------------------------------------------------------
2dvyB           ----------------------------------------------------------------------
3bnyB           ----------------------------------------------------------------------
1bdtA           ----------------------------------------------------------------------
3ehjA           ----------------------------------------------------------------------
2aswA           NTADKIAEGNLEAEVPQNRADEIGILAKSIERLRRSLKVAME----------------------------
1ea6A           ----------------------------------------------------------------------
1bknB           ----------------------------------------------------------------------
2brcA           ----------------------------------------------------------------------
1bmtA           ----------------------------------------------------------------------
2c13A           ----------------------------------------------------------------------
3c2eA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           GASHELKTPIGIISGYAEGIKDGIVDHKDQGVYLDIIIDEAEKMNKLVMDMLELSKLEAGKIDLHIIDFS
2bu8A           DRFYLSRISIRMLINQHTLIFDG--STNPAHPKHIGSIDPNCNVSEVVKDAYDMAKLLCDKYYMASPDLE
2e0aA           TLIKVRNRHHNVVPTMAQGIIEYKVTNQNLQYFLDRFYMNRISTRMLMNQHILIFSDSQTGNPSHIGSID
3d2rA           TLIKVRNRHHNVVPTMAQGIIEYKDTNQNLQYFLDRFYMNRISTRMLMNQHILIFSDSHISIDPNCDVVA
3dgeA           NISHELRTPLTAIKAYAETIYNGELDLSTLKEFLEVIIDQSNHLENLLNELLDFSRLERKSLQINREKVD
2bu2A           TIRNRHNDVVPTMAQGVLEYKDTYGDNQNIQYFLDRFYLSRISIRMLINQHTLIFDPIDPNCNVSEVVKD
3d2rB           TLIKVRNRHHNVVPTMAQGIIEYKACTVDLQYFLDRFYMNRISTRMLMNQHILIFSDSQTGNPSHIGSID
2bu6A           TIRNRHNDVVPTMAQGVLEYKDTYGDDPNIQYFLDRFYLSRISIRMLINQHTLIFDKHIGSIDPNCNVSE
2e0aB           TLIKVRNRHHNVVPTMAQGIIEYKDTNQNLQYFLDRFYMNRISTRMLMNQHILIFSDSQTGNPSHIGSID
3crlA           TIRNRHNDVVPTMAQGVLEYKDTYGDNQNIQYFLDRFYLSRISIRMLINQHTLIFDGSTNPAHPKHIGSI
2btzA           ---NRHNDVVPTMAQGVLEYKDTYGDDPVIQYFLDRFYLSRISIRMLINQHTLIFDKHIGSIDPNCNVSE
3d36B           SISHEIRNPLTAARGFIQLIEEQPLAADKRRQYARIAIEELDRAEAIITDYLTFAKP----APETPEKLN
2c2aA           NISHELRTPLTAIKAYAETIYNSLGDLSTLKEFLEVIIDQSNHLENLLNELLDFSRLERKSLQINREKVD
3clqB           SPCHEHDAVGSAGVTSPNYVHIIKNEFTNLSEQLAKVLRFGANDQSVVDRLIWRDVLGPLDATFCPEGID
3crkB           RHNDVVPTMAQGVLEYKDTYGDDPVSNQNIQYFLDRFYLSRISIRMLINQHTLIFDHICSVSDVVKDAYD
3clqD           SPCHEHDAVGSAGVTSPNYVHIIKNETYNLSEQLAKVLRFGANDQSVVDRLIWRDVLGLHDATFCPEGID
1b3qA           --SQTVRVDIEKLDNLMDLMGE---LVIARSRILETLKKYN--IKELDESLSHLSRITLDLQNVVMKIVP
3crkA           TIRNRHNDVVPTMAQGVLEYKDTYVSNQNIQYFLDRFYLSRISIRMLINQHTLIFDSIDPNCSVSDVVKD
3clqA           SPCHEHDAVGSAGVTSPNYVHIIKNEFTNLSEQLAKVLRFGANDQSVVDRLIWRDVLGLHDATFCPEGID
2avwB           TKTFNGKDDLLAGAATAGNMLHWWFDQKDQIKRYLEEHPEKQKINFNGEQMFDVKE--------AIDTKN
2bu7A           TIRNRHNDVVPTMAQGVLEYKDTYGDDPNIQYFLDRFYLSRISIRMLINQHTLIFDSIDPNCNVSEVVKD
1e51A           ---------------------------------------PQSVLHSGYFHPL-LRAWQTATTTLNASNLI
2bu5A           TIRNRHNDVVPTMAQGVDTYGDDPVSNQNIQYFLDRFYLSRISIRMLINQHTLIFDKHIGSIDPNCNVSE
2avwA           TKTFNGKDDLLAGAATAGNMLHWWFDQNKDQIRYLEEHPEKQKINFNGEQMFDVKEAIDTKNHQLDSKLF
3crlB           TIRNRHNDVVPTMAQGVLEYKDTYGDDPNIQYFLDRFYLSRISIRMLINQHTLIFDGSTNPAHPKHIGKD
1b3qB           --SQTVRVDIEKLDNLMDLMGELVIARSRKKYNIKELDESLSHLSRITLDLQNVVM--------KIRMVP
2ch4B           --------------------------------------------------------------------VP
1bxdA           --------------------------------------------------------------EMPMEMAD
3d36A           SISHEIRNPLTAARGFIQLIEEQPLAADKRRQYARIAIEELDRAEAIITDYLTFAKPAPETPEKLNVKLE
2crkA           TVFKDLFDPIIQDRHGGFKPTDKHKTDLNHENDPHYVLSSRVRTGRSIKGYTLPPHCS------RGERRA
3bh1D           --------------------------------IRERREALGEMGGKLFDDMHASRVLPGFPDNKIAMLDR
3ehjB           RDLVDTLGQKLSLGLKSDLARKLIY-------------KDPEQAARELKSVQQTARTSLNEVRKIVSSKG
2dvyF           ----------------------------------------------------------------------
3cgzA           -------------------------------------------------------------VLLSRELHP
3ckeD           GGYLEYRERDVGKELLAALMRFSMGLKPSELQRVREIDANCSKHLSVVNDIYSYEKELYLCTSVQILAQE
3bnyC           -EYRERDVGKELLAALMRFSMGLKLS-PSELQRVREIDANCSKHLSVVNDIYSYEKELYTLCTSVQILAQ
2ch4A           --------------------------------------------------------------------VP
3bh1A           ----------------------------QSQHIRERREALGEMGGKLFDDMHASRVLPGFPDNKIAMLDR
3ehhB           RDLVDTLGQKLSLGLKSD-------------LARKLIYKDPEQAARELKSVQQTARTSLNEVRKI--VSS
3ehfD           DLHDTLGQKLSLIGLKSDLARKL-------------IYKDPEQAARELKSVQQTARTSLNEVRKIVSSKG
2cw9A           QCENDIIPNVEAISGELDILKD-WCYEATYSQLAHPIQQAKALGLQFHSRILDIDNVDLAGKVEQGPVL-
3b2mB           ----------------------------------------------------------------------
3ehhA           RDLVDTLGQKLSLGLKSDLARKLIY-------------KDPEQAARELKSVQQTARTSLNEV--RKIVSS
1aj6A           ----------------------------------------------------------------------
2ccsA           ----------------------------------------------------------------------
2de0X           RIENGAKELWFFLQSELKKLKN-LEGNELQRHADEFLLDLGHHERSIMTDLYYLSQTDGAGDWREKEAKD
1ah6A           ----------------------------------------------------------------------
3ehfA           DLHDTLGQKLSLIGLKSDLA-------------RKLIYKDPEQAARELKSVQQTARTSLNEVRKIVSSKG
3cgzB           --------------------------------------------------------------------HP
2cgfA           ----------------------------------------------------------------------
1b63A           ----------------------------------------------------------------------
3b2mC           ----------------------------------------------------------------------
2dvyD           ----------------------------------------------------------------------
3bnxA           ---RERDVGKELLAALMRFSMGLKLS-PSELQRVREIDANCSKHLSVVNDIYSYEKCTSVQILAQEADVT
1eh8A           ----------------------------------------------------------------------
1e51B           ----------------------------------------------------------------------
1ah8A           ----------------------------------------------------------------------
3c11A           ----------------------------------------------------------------------
3bmyA           ----------------------------------------------------------------------
2cg9B           ----------------------------------------------------------------------
3cwvA           ----------------------------------------------------------------------
3bp9Y           DCQQLLGTLLTGEEKQR---------------VLLEARKAVTQLPNEVDAAFPLERPDWDTEGRNHLVLY
2dvyC           ----------------------------------------------------------------------
1csgA           GSLTKLKGPLTMMASHYKQHCPPT-PETSCATQIITFESFKENLKDFLLVIPFDC---------------
2akpB           ----------------------------------------------------------------------
3c0eA           ----------------------------------------------------------------------
2dvyA           ----------------------------------------------------------------------
3cgyC           --------------------------------------------------------------------HP
1ah8B           ----------------------------------------------------------------------
3ehgA           ---------------------------------------------------------------------R
2byhA           ----------------------------------------------------------------------
1byqA           ----------------------------------------------------------------------
3ckeB           ---------KELLAALMRFSMGLKLSPS-ELQRVREIDANCSKHLSVVNDIYELYTSILCTSVQILAQEA
3c2wB           HPDDGIAALIPCDGALVMLGGRTLSIRGDF--ERQAGNVLQRLQRDPERDIYHTDNWCCGVLAIRFHRQE
2breA           ----------------------------------------------------------------------
1b62A           ----------------------------------------------------------------------
3bjeA           ----------------------------------------------------------------------
3c2wA           HPDDGIAALIPCDGALVMLGGRTLSIRGDF--ERQAGNVLQRLQRDPERDIYHTDNWCCGVLAIRFHRQE
3c2wF           HPDDGIAALDGALVMLGGRTLSIRGDFERQAGNVLQRLQRDPERDIYHTDNWDCCGVLAIRFHRQESGWI
2c13B           -------------------------------------------------------------------DFS
2bz5A           ----------------------------------------------------------------------
2cg9A           ----------------------------------------------------------------------
2akpA           ----------------------------------------------------------------------
2cwoA           WMEQRIGEMLKEIRAFLKVRVVTPMHKETASDTLNAFLEEYCRITGLARALREKMRKVKSVVLFHHSELL
3cgyA           -------------------------------------------------------------VLLSRELHP
3dt4C           ----------------------------------------------------------------------
3c2wE           HPDDGIAALIPCDGALVMGGRTLSIRGDFERQAGNVL---QRLQRDPERDIYHTDNWCCGVLAIRFHRQE
3cgyB           --------------------------------------------------------------------HP
3bulA           ----------------------------------------------------------------------
1bknA           ----------------------------------------------------------------------
1ei1A           ----------------------------------------------------------------------
1ea6B           ----------------------------------------------------------------------
2dvyB           ----------------------------------------------------------------------
3bnyB           -------VGKELLAALMRFSMGLKLS-PSELQRVREIDANCSKHLSVVNDIYSYEKELYTILCTSVADVT
1bdtA           ----------------------------------------------------------------------
3ehjA           ---------------------------------RKLIYKDPEQAARELKSVQQTARTSLNEVRKIVSSKG
2aswA           ----------------------------------------------------------------------
1ea6A           ----------------------------------------------------------------------
1bknB           ----------------------------------------------------------------------
2brcA           --------------------------------------------------------MASETFEFQAE---
1bmtA           ----------------------------------------------------------------------
2c13A           -------------------------------------------------------------------DFS
3c2eA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           LTELTEEVLVKNSVDINKNNLTVIKNYSPNEDLYVQGDDFKIEQVLTNFVTNAIKYSEPNNQIIIDIKPV
2bu8A           IQEINAAN--------------------SKQPIHMVYVPSHLYHMLFELFKNAMRATVESHESSLILPPI
2e0aA           PNCDVVAVVDQYYLSSPELKLTQVNGKFPDQPIHIVYVPSHLHHMLFELFKNAMRATVEHQENQPSLTPL
3d2rA           VVQDAFECSRMLCDQYYLSSPELKLTQFPDQPIHIVYVPSHLHHMLFELFKNAMRATVEHQENQPSLTPL
3dgeA           LCDLVESAVNAIKEFASSHNVNVLFESNVPCPVEAYIDPTRIRQVLLNLLNNGVKYSKKDAPDKYVILDE
2bu2A           AYDMAKLLCDKYYMASPDLEIQEINAANSKQPIHMVYVPSHLYHMLFELFKNAMRATVESHESSLILPPI
3d2rB           PNCDVVAVVQDAFECSRMLKLTQVNGKFPDQPIHIVYVPSHLHHMLFELFKNAMRATVEHQENQPSLTPI
2bu6A           VVKDAYDMAKLLCDKYYMASPDLEIQANSKQPIHMVYVPSHLYHMLFELFKNAMRATVESHESSLILPPI
2e0aB           PNCDVVAVVQDAFECSPELKLTQVNGKFPDQPIHIVYVPSHLHHMLFELFKNAMRATVEHQENQPSLTPL
3crlA           DPNCSVSDVVKDAYDMPDLEIQEVNATNATQPIHMVYVPSHLYHMLFELFKNAMRATVESHESSLTLPPL
2btzA           VVKDAYDMAKLLCDKYYMASPDEINAANSKQPIHMVYVPSHLYHMLFELFKNAMRATVESHESSLILPPI
3d36B           VKLEIERVIDILRPLANMSCVDIQ---ATLAPFSVIGEREKFRQCLLNVMKNAIEAMPNGGTLQVYVSI-
2c2aA           LCDLVESAVNAIKEFASSHNVNVLFESNVPCPVEAYIDPTRIRQVLLNLLNNGVKYSKKDAPDKYVKVIE
3clqB           LRLLSQALHGDECHNRNVAGSTLLVQALT-PYVQTDFSREQLKEVFEFLGSSDYFSGPTWGAAKCALDAG
3crkB           MAKLLCDKYYMASPDLEIQEVNAT---NATQPIHMVYVPSHLYHMLFELFKNAMRATVESHESSLTLPPL
3clqD           LRLLSQALHGDECHNRNVAGSTLL-VQALTPYVQTDFSREQLKEVFEFLGSSDYFSGPTWGAAKCDAGHN
1b3qA           ISFVFNRFPRMVRDLAKKMNKEVNFIMRGEDTELDRTFVEEIGEPLLHLLRNAIDHGKPPIGTLILSARH
3crkA           AYDMAKLLCDKYYMASPDLEIQEVNATNATQPIHMVYVPSHLYHMLFELFKNAMRATVESHESSLTLPPI
3clqA           LRLLSQALHGDECHNRNVAGSTLLVQ-ALTPYVQTDFSREQLKEVFEFLGSSDYFSGPTWGAAKCALDAG
2avwB           HQLDSKLFEYFKEKAFPYLSTKHLGVFPDHVIDMFINGYRLSLTNHGPTPVKEGSKDPRGGIFDAVFTRG
2bu7A           AYDMAKLLCDKYYMASPDLEIQEINAANSKQPIHMVYVPSHLYHMLFELFKNAMRATVESHESSLILPPI
1e51A           YPIFVTDVPDDIQPITSLPGVARYGVK-RLEEMLRPLVEEGLRCVLIFGVPSRVPKDERGSAADSEESPA
2bu5A           VVKDAYDMAKLLCDKYYMASIQEINAANSKQPIHMVYVPSHLYHMLFELFKNAMRATVESHESSLIL---
2avwA           EYFKEKAFPYLSTKHLGVFP--------DHVIDMFINGYRLSLTNHGPTPVKEGSKDPRGGIFDAVFTRG
3crlB           AYDMAKLLCDKYYMASPDLEIQEVNATNATQPIHMVYVPSHLYHMLFELFKNAMRATVESHESSLTLPPI
1b3qB           ISFVFNRFPRMVRDLAKKMNKEVNFIMRGEDTELDRTFVEEIGEPLLHLLRNAIDHGIEPKEERIAKGKP
2ch4B           ISFVFNRFPRMVRDLAKKMNKEVNFIMRGEDTELDRTFVEEIGEPLLHLLRNAIDHGIEPKEERILSARH
1bxdA           LNAVLGEVIA----AESGYEREIETALYP-GSIEVKMHPLSIKRAVANMVVNAARYGNGW---IKVSSGT
3d36A           IERVIDIL-------RPLANMSCVDIQATLAPFSVIGEREKFRQCLLNVMKNAIEAMPNGGTLQVYVSI-
2crkA           VEKLSVEALNSLTGEFKGKYYPLKSMTEQ-EQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDN
3bh1D           IKDEVEILVNAKDLERHKIRADLGISYEEDVLRLVDVFRDRGFLVEHVVLTQLENDNRLALAFIERL---
3ehjB           IRLKDELINIKQILEAADIFIYE----EEKWPENISLLNENILSCLKEAVTNVVKHSQAK--TCRVDIQQ
2dvyF           ---------------------------------------------------ASVSFENGKIVVRLPITR-
3cgzA           VAPLLDNLISALNKVYQRKGVNISMDISP--EISFVGEQNDFVEVMGNVLDNACKYCLEF----------
3ckeD           ADVTAEAAKRVLFVMCREWELRHQLLVARLSAGLETPGLAAYVEGLEYQMSGNELWSQ------------
3bnyC           EADVTAEAAKRVLFVMCREWELRHQLLVARLSAEGTPGLAAYVEGLEYQMSGNELWSQ------------
2ch4A           ISFVFNRFPRMVRDLAKKMNKEVNFIMRGEDTELDRTFVEEIGEPLLHLLRNAIDHGIEPKEERIAKGKP
3bh1A           IKDEVEILVNAKDLERHKIRADLGISYEEDVLRLVDVFRDRGFLVEHVVLTQLENDNRLALAFIE---RL
3ehhB           KGIRLKDELINIKQILEAADIFI--YEEEKWPENISLLNENILSCLKEAVTNVVKHSQA--KTCRVDIQQ
3ehfD           IRLKDELINIKQILEAADIFIYE------EWPENISLLNENILSCLKEAVTNVVKHSQA-KTCRVDIQ-Q
2cw9A           ----------------IITFQAQLVVVRNPKGEVVEGDPDKVLRLYVWALCRDQDELNPYAAWRLLDISA
3b2mB           ------KLTVTKNLDLLIPNTDFTFKIEP--DTTVNEDGNKFKGVALNTPMTKVTYTNSDKGGSNTKTAE
3ehhA           KGIRLKDELI--NIKQILEAADIFIYEEEKWPENISLLNENILSCLKEAVTNVVKHS-QAKTCRVDIQ-Q
1aj6A           -----------------LKGLDAVRKR-PGMYIGDTDDGTGLHHMVFEVVDNAIDEALAGHCKEIIVT--
2ccsA           --------------EVETFAFQAE--IAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYETLTDPIP
2de0X           LTELVQRRITYLQNPKDCSKAKKLVCNINKGCGYGCQLHHVVYC--FMIAYGTQRTLILESQNWRYATGG
1ah6A           -------------------TFEFQAEITQLMSLIINTVYSNKEIFLRELISNASDALDKIRYKSLSDPTP
3ehfA           IRLKDELINIKQILEAAD----IFIYEEEKWPENISLLNENILSCLKEAVTNVVKHSQA-KTCRVDIQQ-
3cgzB           VAPLLDNLISALNKVYQRKGVNISMDISP--EISFVGEQNDFVEVMGNVLDNACKYCLEFVEISA-----
2cgfA           -------------------TFEFQAEITQLMSLIINTVYSNKEIFLRELISNASDALDKIRYKSLSDPKP
1b63A           -------------------PIQVLPPQLAN-QIAAGEVVERPASVVKELVENSLDAGAT----RIDIDIE
3b2mC           -----TKNLDLVNSNALIPNTDFTFKIEP--DTTVNEDGNKFKGVALNTPMTKVTYTNSDKGGSNTKTAE
2dvyD           ---------------------------------------------------ASVSFENGKIVVRLPITR-
3bnxA           AEAAKRVLFVMCREWELRHQLLVA---RLSAEGLETPGLAAYVEGLEYQMSGNELWSQ------------
1eh8A           ----------------------------------LHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQ---
1e51B           ---------------------------QSVLHSGYFHPLLRAWQTATTTLNASNLIYPIFVTDVPDDIQP
1ah8A           -------------------TFEFQAEITQLMSLIINTVYSNKEIFLRELISNASDALDKIRYKSLSDPKP
3c11A           ----------------ASETFEFQAEITQLMSLIINTVYSNKEIFLRELISNASDALDKIRYKSLSDITP
3bmyA           ---------------------------AQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDPSK
2cg9B           -------------------TFEFQAEITQLMSLIINTVYSNKEIFLRELISNASDALDKIRYKSLSDPKQ
3cwvA           ----------------------------------GDVGEYGLHHLVYFLLDVAYEEARRGECRDVVLE--
3bp9Y           RQLLLAGL--------------------------------------------------------------
2dvyC           ---------------------------------------------MIHLTSVEASVSFENGKIVVRLPIT
1csgA           ----------------------------------------------------------------------
2akpB           ----------------------------------ISNASDALDKIRYKSLSDPKQL--ETEPDLFIRITP
3c0eA           ----------------ASETFEFQAEITQLMSLIINTVYSNKEIFLRELISNASDALDKIRYKSLSDPKQ
2dvyA           ---------------------------------------------MIHLTSVEASVSFENGKIVVRLPIT
3cgyC           VAPLLDNLISALNKVYQRKGVNISMDISP--EISFVGEQNDFVEVMGNVLDNACKYCLEF---VEISARQ
1ah8B           ----------------------------QLMSLIINTVYSNKEIFLRELISNASDALDKIRYKSLSDPKP
3ehgA           LKDELINIKQ----ILEAADIMFIYEEEKWPENISLLNENILSMCLKEAVTNVVKHSQAK--TCRVDIQQ
2byhA           -------------------TFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALLDSGKELHINLIP
1byqA           -------------------TFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKSGKELHINLIP
3ckeB           DVTAEAAKLFVMCREWELRHQLLVAR--LSAEGLETPGLAAYVEGLEYQMSGNELWSQT-----------
3c2wB           SGWIFWFR--------------------------------------------------------------
2breA           -------------------TFEFQAEITQLMSLIINTVYSNKEIFLRELISNASDALDKIRYKSLSDPKP
1b62A           -------------------PIQVLPPQLAN-QIAAGEVVERPASVVKELVENSLDAGAT----RIDIDIE
3bjeA           ----------------------------LADRIIFVGDPGRVDVISGYFDKDSIRASRDHREIRFATGTY
3c2wA           SGWIFWFREVH----------RIRWGGKPEKLLTIGPSGPRLTP---RGSFEAWEE--------------
3c2wF           FWEEVLTIGPSGPRLTPRGSFEAWEEVVRGHSTPWSETDLAIAEKLRLDLMELCLNHA------------
2c13B           RRLVRENVLTVDDLI-----LPVFVLDGVNQRESIPSMPGVERLSIDQLLIEAEEWVALGIPALALFPVT
2bz5A           --------------EVETFAFQAEIA--QLMSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDPSP
2cg9A           -------------------TFEFQAEITQLMSLIINTVYSNKEIFLRELISNASDALDKIRYKSLSDPTP
2akpA           ----------------------------------ISNASDALDKIRYKSLSDPKQLETEPDLFIRITP--
2cwoA           KFEVTENMFSYTELLKLNLSLRVISSQILG----------------------------------------
3cgyA           VAPLLDNLISALNKVYQRKGVNISMDISP--EISFVGEQNDFVEVMGNVLDNACK---------------
3dt4C           ----------------------------------IQGSLDSLPQEVRKFVEGNAQLCQPEYIHICDGSEE
3c2wE           SGWIFW----------------------------------------------------------------
3cgyB           VAPLLDNLISALNKVYQRKGVNISMDISP--EISFVGEQNDFVEVMGNVLDNACK---------------
3bulA           ----------------------------------------------------------------------
1bknA           ----------------------------------------RPASVVKELVENSLDAGATRIDIDI----E
1ei1A           -----------------LKGLDAVRKRPGMY-IGDTDDGTGLHHMVFEVVDNAIDEALAGHCKEIIV--T
1ea6B           ------------------------------------QVVLSLSTAVKELVENSLDAGATNIDLKLKD---
2dvyB           -------------------------------------------------VEASVSFENGKIVVRLPITR-
3bnyB           AEAAKRVL-FVMCREWELRHQLLVARLSAEGL--ETPGLAAYVEGLEYQMSGNELWSQ------------
1bdtA           -----------------------------------------------------MKGMSKMPQFNLRWPRE
3ehjA           IRLKDELINIKQILEAADIFIYEEEKWPEN----ISLLNENILSCLKEAVTNVVKHSQA-KTCRVDIQ-Q
2aswA           ----------------------------------------------------------------------
1ea6A           ------------------------------------QVVLSLSTAVKELVENSLDA----GATNIDLKLK
1bknB           ----------------------------------------RPASVVKELVENSLDAGAT----RIDIDIE
2brcA           ITQLMSLIINTVYSNKE----IFLREL-------ISNASDALDKIRYKSLSDPKQLETEPD--LFIRITP
1bmtA           ----------------------------------------------------------------------
2c13A           RRLVRE-----NVLTVDDLILPVFVLDGVNQRESIPSMPGVERLSIDQLLIEAEEWVALGIPALALFPVT
3c2eA           ----------------------------------------------------------PVYEHLLPVNGA


                         .         .         +         .         .         .         .:490
query           EEDKIYFSIENTGAHIPDSDINKIWTQFYRGDTSRNRGSRSTGLGLSIVKNLLQAHESEFGVMNTENGVK
2bu8A           GEEDLSIKMSDRGGGVPLRKIERLFSYMYSTPLAGF------GYGLPISRLYAKYFQGDLQLFSMEGGTD
2e0aA           GKEDLTIKISDRGGGVPLRIIDRLFSYTYSTAPTPNAPLAGFGYGLPISRLYAKYFQGDLNLYSLSGGTD
3d2rA           GKEDLTIKISDRGGGVPLRIIDRLFSYTYSTAPTAPL--AGFGYGLPISRLYAKYFQGDLNLYSLSGGTD
3dgeA           KDGGVLIIVEDNGIGIPDHAKDRIFEQFYRVDSSLTYEVPGTGLGLAITKEIVELHGGRIWVESEVGGSR
2bu2A           K-VMVALGEEDLSIKMSDRGGGVPLRKIERLFSYMYSTLAGFGYGLPISRLYAKYFQGDLQLFSMEGGTD
3d2rB           EKEDLTIKISDRGGGVPLRIIDRLFSYTYSTAPTPPLA--GFGYGLPISRLYAKYFQGDLNLYSLSGGTD
2bu6A           KEEDLSIKMSDRGGGVPLRKIERLFSYMYS---------TAPGYGLPISRLYAKYFQGDLQLFSMEGGTD
2e0aB           GKEDLTIKISDRGGGVPLRIIDRLFSYTY-----STAPLAGFGYGLPISRLYAKYFQGDLNLYSLSGGTD
3crlA           GEEDLSIKMSDRGGGVPLRKIERLFSYMYSTAP-----LAGFGYGLPISRLYAKYFQGDLQLFSMEGGTD
2btzA           GEEDLSIKMSDRGGGVPLRKIERLFSYMYS---------TAPGYGLPISRLYAKYFQGDLQLFSMEGGTD
3d36B           DNGRVLIRIADTGVGMTKEQLERLGEPYFTTKGVKGT-----GLGMMVVYRIIESMNGTIRIESEIHGTT
2c2aA           KDGGVLIIVEDNGIGIPDHAKDRIFEQFYR---------VDTGLGLAITKEIVELHGGRIWVESEVGGSR
3clqB           HNNSTIVTTCRNGVEFGIRVSGIGGNHWFTGPAQR---VIGPFAGYTQEDAGLDGDSAITETYGVGGFAA
3crkB           GEEDLSIKMSDRGGGVPLRKIERLFSYMYSTA---------PGYGLPISRLYAKYFQGDLQLFSMEGFAV
3clqD           VENSTIVTTCRNGVEFGIRVSGIGGNHWFTGPAQR---VIGPFAGYTQEDAGLDGDSAITETYGVGGFAA
1b3qA           EGNNVVIEVEDDGRGIDKEKIIRKAIEKGLIDESKAFVPGFSGVGMDVVKNVVESLNGSMGIESEKDGTK
3crkA           KEEDLSIKMSDRGGGVPLRKIERLFSYMYS---------TAPGYGLPISRLYAKYFQGDLQLFSMEGGTD
3clqA           HNNSTIVTTCRNGVEFGIRVSGIGGNHWFTGPAQR---VIGPFAGYTQEDAGLDGDSAITETYGVGGFAA
2avwB           DQSKLLHDFKEKNLKEISDLIKKELTEGKAGLSHTYANVRINHVINLWGADFDSNGNLKAIYVTDSDSAS
2bu7A           GEEDLSIKMSDRGGGVPLRKIERLFSYMYSTA---------PGYGLPISRLYAKYFQGDLQLFSMEGGTD
1e51A           IEIHLLRKTFPNLLVACDVCLCPYTSHGHCGLLSGAFRAEESRQRLAEVALAYAKAGCQVVAPSDMMDGR
2bu5A           PPIKVMVALGEEDLSIKMSDRGGGVPLRKIERLFSYMYSTAPGYGLPISRLYAKYFQGDLQLFSMEGGTD
2avwA           DQSKLLHDFKEKNLKEISDLIKKELTGKALGLSHTYANVRINHVINLWGADFDSNGNLKAIYVTDSDSAS
3crlB           KEEDLSIKMSDRGGGVPLRKIERLFSYMYSTAPLAG-----FGYGLPISRLYAKYFQGDLQLFSMEGFTD
1b3qB           PIGTLVIEVEDDGRGIDKEKINFLFVPGFST-KEKVSEVSGRGVGMDVVKNVVESLNGSMGIESEKDGTK
2ch4B           EGNNVVIEVEDDGRGIDKEKIIRKAIEKGLIDESKLNFLFVPGFSMDVVKNVVESLNGSISIESEKDKGT
1bxdA           EPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTI--SGTGLGLAIVQRIVDNHNGMLELGTSERGLS
3d36A           DNGRVLIRIADTGVGMTKEQLERLGEPYF-----TTKGVKGTGLGMMVVYRIIESMNGTIRIESEIHGTT
2crkA           KSFLVWVNEEDHLRVISMEKGGNMKEVFRRFCVGLQKIEE-IFKKAGHPFMWNEHLGYVLTCPSNLGGLR
3bh1D           QRLGIKVSRHRVIPGYPTDMDRIVSDEGFGLNEYAETTRDLPGPGSGKLATQVYHEHKRGVAAGYAKETF
3ehjB           LWKEVVITVSDDGTFKGEEN---------------------SFHGL-LGRERLEFANGSLHIDTENGKLT
2dvyF           PTSKIRVKKIENGVGIPVSTRKKSFPSDENLRDYYIEWQIKYDYELSRMVRLAHEHGILTYNDIYELLKF
3cgzA           -----------VEISARQTDDHLHIFVEDDGPGIPHTLRPGQGVGLAVAREITEQYAGQIIASDSLLGAR
3ckeD           ----------------------------------------------------------------------
3bnyC           ----------------------------------------------------------------------
2ch4A           PIGTLLIDESKAATLSDQEILNFLFVPGFSTKEKVSE-VSGRGVGMDVVKNVVESLNGSISIESEKDKGT
3bh1A           QRLGIKVSRHRVIPGYPTDMDRIVSDEGFGLNEYAETAPGPGSGKLATCLSQVYHEHKRGVAAGYAKETF
3ehhB           LWKEVVITVSDDGTFKGEENSHGL---LGRERLEFANGSDTEGTKLTAIPN-------------------
3ehfD           LWKEVVITVSDDGTFKGEHGLGRERLEFANGSL---HIDTENGTKLTAIPN-------------------
2cw9A           SST-------------------------------------------------------------------
3b2mB           FDFVTFEKPGVYYYKVTEEKIDKVPGVSYDTTSYTVQVLWNEEQQKPVATYIVGYKEGSKVPQFKNSLDS
3ehhA           LWKEVVITVSDDGTFKGHGLLGRERLEFANGSLHIDTEN---GTKLTAIPN-------------------
1aj6A           IHADNSVSVQDDGRGIPTGIVSAAEVIMTVLHAGGKFSGGLHGVGVSVV----NALSQKLELVIQHEGKI
2ccsA           NKQDRTLTIVDTGIGMTKADLINNLGTIAKSGTKAFMEALQAG---ADISMIGQFGVGFYSALVAEKVTV
2de0X           WETVFRPVSETCTDRSGIS---------------------------------------------------
1ah6A           KPEQKVLEIRDSGIGMTKAELINNLGTIAKSGTKAFM--EALSAG-ADVSMIGQFGVGFYSLFLVADRVQ
3ehfA           LWKEVVITVSDDGTFKGEHGL-LGRERLEFANGSLHIDTE-NGTKLTAIPN-------------------
3cgzB           ------------RQTDDHLHIFVEDDGPGIPHSKRSTLRPGQGVGLAVAREITEQYAGQIIASDSLLGAR
2cgfA           KPEQKVLEIRDSGIGMTKAELINNLGTIAKSGTKAFME----ALSAGADVSMIGQFGVGFYSLFLVADRV
1b63A           RGGAKLIRIRDNGCGIKKDELALALARHATSDLEAIISLGFRGEALASISSV------------------
3b2mC           FDEVTFEKPGVYYYKVTEEKIDKVPGVSYDTTSYTVQVHVLEEQQKPVATYIVGYKEGSKVPIQFKSLDS
2dvyD           PTSKIRVKKIENGVGIPVSTRKKSFPSDENLRDYYYARDGKYDYELSRMVRLAHEH-GILTYNDIYELLK
3bnxA           ----------------------------------------------------------------------
1eh8A           LAALAGNPKAARAVGGAMRGNPVPILIPHRVVCSSGAVG-NYSGGLAVKEWLLAHE--------------
1e51B           VKRLEEMLRPLVEEGLRCVLIFGVPSRVPKDADSEEPAIEAIHLLRKTFPNLLVACDVCLCPYAEESR--
1ah8A           KPEQKVLEIRDSGIGMTKAELINNLGTIAKSGTKAFM----EALSAGADVSMIGQFGVGFYSLF-LVADR
3c11A           KPEQKVLEIRDSGIGMTKAELINNLGTIAAAGTKAFM----EALSAGADVSMIGQFGVGFYSL-------
3bmyA           NKQDRTLTIVDTGIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAYLVAEKVTV--
2cg9B           KPEQKVLEIRDSGIGMTKAELINNLGTIAKSGTKAFM----EALSAGADVSMIGQFGVGFYSLFLVARVQ
3cwvA           VGGDGSIALFCTSRTVTAENLVRVATGAGFLGRPPGDGWG-WDSMLVVSLALSSRYQVDIWADGRQWRVM
3bp9Y           ----------------------------------------------------------------------
2dvyC           RTSKIRVKKIENGVGIPVSTRKKSFPSDE------------NLRDYYIEWQISYARDGKYDYLAHEHGIL
1csgA           ----------------------------------------------------------------------
2akpB           KPEQKVLEIRDSGIGMTKAELINNLGTIAKSGTKAFMEALSAGA---DVSMIGQFGVGFYSLFLVADVQV
3c0eA           LPEQKVLEIRDSGIGMTKAELINNLGTIAAAGTKAFMEALSAG---ADVSMIGQFGVGFYSLFLVADRVQ
2dvyA           RTSKIRVKKIENGVGIPVSTRKKSFPSDE------------NLRDYYIEWQISYARDGKYDY--------
3cgyC           TDDHLHIFVEDDGPGIPGLAVAREITEQYAGIIASDSLLGGARMEVVFGRQ-------------------
1ah8B           KPEQKVLEIRDSGIGMTKAELINNLGTIAKSGTKAFM----EALSAGADVSMIGQFGVGFYSLFLVADRV
3ehgA           LWKEVVITVSDDGTFKGEENSFSKGHGLL------------------GMRERLEFANGSLHI-DTENGTK
2byhA           NKQDRTLTIVDTGIGMTKADLINNLGTIAKSGTKAFM----EALQAGADISMIGQFGVGFYSAYLVAE--
1byqA           NKQDRTLTIVDTGIGMTKADLINNLGTIAKSGTKAFMEA-------------------------------
3ckeB           ----------------------------------------------------------------------
3c2wB           ----------------------------------------------------------------------
2breA           KPEQKVLEIRDSGIGMTKAELINNLGTIAKSGTKAFM----EALSAGADVSMIGQFGVGFYSLFLVAD--
1b62A           RGGAKLIRIRDNGCGIKKDELALALARHATDDLEAIISLGFRGEALASISSV------------------
3bjeA           KGTVISTGMGVDNIEIVLNEIHALKEYDMERGQWRHRKGDADAPSAGPFFDPSTMKIIRLGTCGSPALAL
3c2wA           ----------------------------------------------------------------------
3c2wF           ----------------------------------------------------------------------
2c13B           PVEKLDAAEAYNPEGIAQRATRALRERFPELGIITDVALDPDGILDDDGYVLNDVSIDVLVRQALSHEAG
2bz5A           NKQDRTLTIVDTGIGMTKADLINNLGTIAKSGTKAFME--------------------------------
2cg9A           KPEQKVLEIRDSGIGMTKAELINNLGTIAKSGTKAFM----EALSAGADVSMIGQF--------------
2akpA           KPEQKVLEIRDSGIGMTKAELINNLGTIAK----SGTKAFMEALSAGADVSMIGQFGVGFYSLFLVRVQV
2cwoA           ----------------------------------------------------------------------
3cgyA           --------------YCLEFVEISARQTDDHLHIFVEDDGPGIPVGLAVAREITEQYAGQIIASDSLLGAR
3dt4C           EYGRLLAHMQEEGVIRKLKKYDNCWLALTDPRDVAR----------------------------------
3c2wE           ----------------------------------------------------------------------
3cgyB           --------------YCLEFVEISARQTDDHLHIFVEDDGPGIPHGLAVAREITEQYAGQIIASDSLLGAR
3bulA           -------------------RSWEVNKRLEYSLVKGITEFIEQDTEEARQQATRPCEVIEGPLMDGMNVV-
1bknA           RGGAKLIRIRDNGCGIKKDELALALAIASLDDLEAIISLGFRGEALASISSV------------------
1ei1A           IHADNSVSVQDDGRGIPTGIHPEEGVSAAEVIMTVL----------------------------------
1ea6B           -YGVDLIEVSDNGCGVEEENFEGLTLEALSSLCALSVTISTCHASAKVGTRLMFDHNGKIIQKTPYPRPR
2dvyB           PTSKIRVKKIENGVGIPVSTRKKSFPSDENLRDYYI----------------------------------
3bnyB           ----------------------------------------------------------------------
1bdtA           VLDLVRKVAEENGRSVNSEIYQRVMESFKKEG--------------------------------------
3ehjA           LWKEVVITVSDDGTFKGE---------------------ENSFHGL-LGRERLEFANGSLHI-DTENGTK
2aswA           ----------------------------------------------------------------------
1ea6A           DYGVDLIEVSDNGCGVEEENFEGLTLEALSSL--------------------------------------
1bknB           RGGAKLIRIRDNGCGIKKDEL-----ALALAEAIISLGFRGEALATAEQQEAWQAYMNVTVKPAAHVGTT
2brcA           KPEQKVLEIRDSGIGMTKAELINNLGTIAKSGTKA-----------------------------------
1bmtA           ------------AEWRSWEVNKRLEYSLVKGITEFIEQDTEEARQQATRPIEVIEGPLMDGMNVVGDLFG
2c13A           PVEKLDAAEAYNPEGIAQRATRALRERFPELG---------IITDVALDPFTTHGQDGILDDDGYVNDVS
3c2eA           WRQDVNWLSEDVPSFDFGGYVV----GSDLKEANLYCKQDGMLCGVPFAQEVFNQC--------------


                         *         .         .         .         .         +         .:560
query           FYFTLKKSKEIDEVEEx
2bu8A           AVIYLKALSTDSVERL-
2e0aA           AIIYLKALSSESIEKL-
3d2rA           AIIYLKALSSESIEKL-
3dgeA           FFVWIPKDR--------
2bu2A           AVIYLKALSTDSVERL-
3d2rB           AIIYLKALSSESIEKL-
2bu6A           AVIYLKALSTDSVERL-
2e0aB           AIIYLKALSSESIEKL-
3crlA           AVIYLKALSTDSVERL-
2btzA           AVIYLKALSTDSVERL-
3d36B           VSIYL------------
2c2aA           FFVWIPKDR--------
3clqB           APAIV------------
3crkB           IYLKALSTDSVERLP--
3clqD           APAIV------------
1b3qA           VTIRL------------
3crkA           AVIYLKALSTDSVERL-
3clqA           APAIV------------
2avwB           IGMKKYFVGVNSAGK--
2bu7A           AVIYLKALSTDSVERL-
1e51A           VEA--------------
2bu5A           AVIYLKALSTDSVERL-
2avwA           IGMKK------------
3crlB           AVIYLKALSTDSVERL-
1b3qB           VTIRL------------
2ch4B           KVT--------------
1bxdA           IRAWLPVPVTRAQGTT-
3d36A           VSIYL------------
2crkA           GGVHV------------
3bh1D           PIW--------------
3ehjB           AIPNN------------
2dvyF           ADDV-------------
3cgzA           MEVVFGRQHPTQKEE--
3ckeD           -----------------
3bnyC           -----------------
2ch4A           KVT--------------
3bh1A           PIWNLPLEHPVNLAYE-
3ehhB           -----------------
3ehfD           -----------------
2cw9A           -----------------
3b2mB           TTLTVKKKVSGTGGDR-
3ehhA           -----------------
1aj6A           HRQ--------------
2ccsA           ITKHNDD----------
2de0X           -----------------
1ah6A           VISKSNDDEQYIWES--
3ehfA           -----------------
3cgzB           MEVVF------------
2cgfA           QVISKSNDDEQYIWES-
1b63A           -----------------
3b2mC           TTLTV------------
2dvyD           FADD-------------
3bnxA           -----------------
1eh8A           -----------------
1e51B           -----------------
1ah8A           VQVI-------------
3c11A           -----------------
3bmyA           -----------------
2cg9B           VISKSNDDEQYIWES--
3cwvA           GEHGH------------
3bp9Y           -----------------
2dvyC           TYND-------------
1csgA           -----------------
2akpB           ISKSNDDEQYIWE----
3c0eA           VIS--------------
2dvyA           -----------------
3cgyC           -----------------
1ah8B           QVI--------------
3ehgA           LTMAI------------
2byhA           -----------------
1byqA           -----------------
3ckeB           -----------------
3c2wB           -----------------
2breA           -----------------
1b62A           -----------------
3bjeA           AVTRH------------
3c2wA           -----------------
3c2wF           -----------------
2c13B           AQVV-------------
2bz5A           -----------------
2cg9A           -----------------
2akpA           ISKSNDDEQYIWE----
2cwoA           -----------------
3cgyA           MEVVFGRQHPTQK----
3dt4C           -----------------
3c2wE           -----------------
3cgyB           MEVVF------------
3bulA           -----------------
1bknA           -----------------
1ei1A           -----------------
1ea6B           GTT--------------
2dvyB           -----------------
3bnyB           -----------------
1bdtA           -----------------
3ehjA           L----------------
2aswA           -----------------
1ea6A           -----------------
1bknB           LEVLD------------
2brcA           -----------------
1bmtA           EGKM-------------
2c13A           IDVLVRQAL--------
3c2eA           -----------------