[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for cper0:BAB81731.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3cl5A.bssp"
#ERROR : Can't open dsspfile "1clkA.bssp"
#ERROR : Can't open dsspfile "2btvB.bssp"
#ERROR : Can't open dsspfile "3banB.bssp"
#ERROR : Can't open dsspfile "2d32D.bssp"
#ERROR : Can't open dsspfile "2a5hA.bssp"
#ERROR : Can't open dsspfile "2e7sB.bssp"
#ERROR : Can't open dsspfile "3dntA.bssp"
#ERROR : Can't open dsspfile "3cqiA.bssp"
#ERROR : Can't open dsspfile "2e7sC.bssp"
#ERROR : Can't open dsspfile "3ebjC.bssp"
#ERROR : Can't open dsspfile "3cl4A.bssp"
#ERROR : Can't open dsspfile "2e7sK.bssp"
#ERROR : Can't open dsspfile "2a5hB.bssp"
#ERROR : Can't open dsspfile "2e7sA.bssp"
#ERROR : Can't open dsspfile "2e7sH.bssp"
#ERROR : Can't open dsspfile "3cqjB.bssp"
#ERROR : Can't open dsspfile "2e7sN.bssp"
#ERROR : Can't open dsspfile "3cqhA.bssp"
#ERROR : Can't open dsspfile "3chvA.bssp"
#ERROR : Can't open dsspfile "2e7sG.bssp"
#ERROR : Can't open dsspfile "3dtvA.bssp"
#ERROR : Can't open dsspfile "3cqiB.bssp"
#ERROR : Can't open dsspfile "3c8fA.bssp"
#ERROR : Can't open dsspfile "3biyA.bssp"
#ERROR : Can't open dsspfile "3cb8A.bssp"
#ERROR : Can't open dsspfile "2cb6A.bssp"
#ERROR : Can't open dsspfile "3e65A.bssp"
#ERROR : Can't open dsspfile "3cixA.bssp"
#ERROR : Can't open dsspfile "2e7sD.bssp"
#ERROR : Can't open dsspfile "1eb3A.bssp"
#ERROR : Can't open dsspfile "3ciwA.bssp"
#ERROR : Can't open dsspfile "3dx5A.bssp"
#ERROR : Can't open dsspfile "3dcxA.bssp"
#ERROR : Can't open dsspfile "2bw2A.bssp"
#ERROR : Can't open dsspfile "3cqhB.bssp"
#ERROR : Can't open dsspfile "1aw5A.bssp"
#ERROR : Can't open dsspfile "3cqjA.bssp"
#ERROR : Can't open dsspfile "3bz6A.bssp"
#ERROR : Can't open dsspfile "1dxiA.bssp"
#ERROR : Can't open dsspfile "3cnyA.bssp"
#ERROR : Can't open dsspfile "3c6cA.bssp"
#ERROR : Can't open dsspfile "3c7wA.bssp"
#ERROR : Can't open dsspfile "3dfuB.bssp"
#ERROR : Can't open dsspfile "2dgmE.bssp"
#ERROR : Can't open dsspfile "3e96B.bssp"

## Summary of PDB Search
:434
    2e-38   8%  3cl5A  [x.x.x] HEMAGGLUTININ-ESTERASE
    2e-32  10%  1clkA  [c.1.15] XYLOSE ISOMERASE
    1e-31  14%  2btvB  [e.28.1] PROTEIN (VP3 CORE PROTEIN)
    2e-31  10%  3banB  [x.x.x] D-MANNONATE DEHYDRATASE
    3e-31   7%  2d32D  [x.x.x] GLUTAMATE--CYSTEINE LIGASE
    2e-30  11%  2a5hA  [x.x.x] L-LYSINE 2,3-AMINOMUTASE
    2e-29  14%  2e7sB  [x.x.x] RAB GUANINE NUCLEOTIDE EXCHANGE FACTOR SEC2
    3e-29  12%  3dntA  [x.x.x] PROTEIN HIPA
    7e-29   7%  3cqiA  [x.x.x] L-RIBULOSE-5-PHOSPHATE 3-EPIMERASE ULAE
    1e-28  14%  2e7sC  [x.x.x] RAB GUANINE NUCLEOTIDE EXCHANGE FACTOR SEC2
    3e-28  12%  3ebjC  [x.x.x] POLYMERASE ACIDIC PROTEIN
    6e-28   8%  3cl4A  [x.x.x] HEMAGGLUTININ-ESTERASE
    9e-28  14%  2e7sK  [x.x.x] RAB GUANINE NUCLEOTIDE EXCHANGE FACTOR SEC2
    1e-26  11%  2a5hB  [x.x.x] L-LYSINE 2,3-AMINOMUTASE
    4e-26  14%  2e7sA  [x.x.x] RAB GUANINE NUCLEOTIDE EXCHANGE FACTOR SEC2
    3e-25  15%  2e7sH  [x.x.x] RAB GUANINE NUCLEOTIDE EXCHANGE FACTOR SEC2
    4e-25   7%  3cqjB  [x.x.x] L-RIBULOSE-5-PHOSPHATE 3-EPIMERASE ULAE
    1e-24  14%  2e7sN  [x.x.x] RAB GUANINE NUCLEOTIDE EXCHANGE FACTOR SEC2
    3e-24  10%  3cqhA  [x.x.x] L-RIBULOSE-5-PHOSPHATE 3-EPIMERASE ULAE
    4e-24   6%  3chvA  [x.x.x] PROKARYOTIC DOMAIN OF UNKNOWN FUNCTION (DUF849)
    1e-22  17%  2e7sG  [x.x.x] RAB GUANINE NUCLEOTIDE EXCHANGE FACTOR SEC2
    4e-22  11%  3dtvA  [x.x.x] ARYLMALONATE DECARBOXYLASE
    9e-21   9%  3cqiB  [x.x.x] L-RIBULOSE-5-PHOSPHATE 3-EPIMERASE ULAE
    3e-20  11%  3c8fA  [x.x.x] PYRUVATE FORMATE-LYASE 1-ACTIVATING ENZYME
    1e-19  12%  3biyA  [x.x.x] HISTONE ACETYLTRANSFERASE P300
    1e-19  11%  3cb8A  [x.x.x] PYRUVATE FORMATE-LYASE 1-ACTIVATING ENZYME
    3e-19   6%  2cb6A  [x.x.x] MOSQUITOCIDAL TOXIN
    4e-19   7%  3e65A  [x.x.x] NITRIC OXIDE SYNTHASE, INDUCIBLE
    1e-18  16%  3cixA  [x.x.x] FEFE-HYDROGENASE MATURASE
    1e-18  12%  2e7sD  [x.x.x] RAB GUANINE NUCLEOTIDE EXCHANGE FACTOR SEC2
    5e-17  14%  1eb3A  [c.1.10] 5-AMINOLAEVULINIC ACID DEHYDRATASE
    3e-16  12%  3ciwA  [x.x.x] FEFE-HYDROGENASE MATURASE
    4e-15  10%  3dx5A  [x.x.x] UNCHARACTERIZED PROTEIN ASBF
    7e-15   9%  3dcxA  [x.x.x] PROTEIN OF UNKNOWN FUNCTION (DUF1696) WITH
    2e-14   6%  2bw2A  [x.x.x] BYPASS OF FORESPORE C
    2e-14   8%  3cqhB  [x.x.x] L-RIBULOSE-5-PHOSPHATE 3-EPIMERASE ULAE
    2e-13  12%  1aw5A  [x.x.x] 5-AMINOLEVULINATE DEHYDRATASE
    4e-13   8%  3cqjA  [x.x.x] L-RIBULOSE-5-PHOSPHATE 3-EPIMERASE ULAE
    8e-13  14%  3bz6A  [x.x.x] UPF0502 PROTEIN PSPTO_2686
    1e-12  11%  1dxiA  [c.1.15] D-XYLOSE ISOMERASE
    4e-11  10%  3cnyA  [x.x.x] INOSITOL CATABOLISM PROTEIN IOLE
    5e-10  11%  3c6cA  [x.x.x] 3-KETO-5-AMINOHEXANOATE CLEAVAGE ENZYME
    1e-09  14%  3c7wA  [x.x.x] LYSOZYME
    6e-06   8%  3dfuB  [x.x.x] UNCHARACTERIZED PROTEIN FROM 6-PHOSPHOGLUCONATE
    2e-04  13%  2dgmE  [c.67.1 (1pmmA)] GLUTAMATE DECARBOXYLASE BETA
    0.001  21%  3e96B  [x.x.x] DIHYDRODIPICOLINATE SYNTHASE
:434

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGRARRQNPEA
3cl5A           --DFYNYTGEGQQIIFYEGVNF-TPYHAFKCTTSGS-NDIWMQNKGLFYTQVYKNMAVYR-SLTFVNVPY
1clkA           --------------------------------------------------------------SYQPTPED
2btvB           ----------------------------------------------------------------------
3banB           ----------------------------------------------------------------------
2d32D           GALMQTISGVHYNFSLPMAFWQAKAKEFRVIRNYYRFGWVIPYLFGASPAISSSFLTSLPFEKTPYATSL
2a5hA           -------------------------------------------------DVSDADDWRWQVRNRIETVEE
2e7sB           ----------------------------------------------------------------------
3dntA           ----------------------------------------------------------------------
3cqiA           ----------------------------------------------------------------------
2e7sC           ----------------------------------------------------------------------
3ebjC           ----------------------------------------------------------------------
3cl4A           -------------------------------------------------------------NVPYVYNGS
2e7sK           ----------------------------------------------------------------------
2a5hB           ----------------------------------------------------DWNDWRWQVRNRIETVEE
2e7sA           ----------------------------------------------------------------------
2e7sH           ----------------------------------------------------------------------
3cqjB           ----------------------------------------------------------------------
2e7sN           ----------------------------------------------------------------------
3cqhA           ----------------------------------------------------------------------
3chvA           ----------------------------------------------------------------------
2e7sG           ----------------------------------------------------------------------
3dtvA           ----------------------------------------------------------------------
3cqiB           ----------------------------------------------------------------------
3c8fA           ----------------------------------------------------------------------
3biyA           ----------------------------------------------------------------------
3cb8A           ----------------------------------------------------------------------
2cb6A           ----------------------------------------------------------------------
3e65A           ----------------------------------------------------------------------
3cixA           ----------------------------------------------------------------------
2e7sD           ----------------------------------------------------------------------
1eb3A           ----------------------------------------------------------------------
3ciwA           ----------------------------------------------------------------------
3dx5A           ----------------------------------------------------------------------
3dcxA           ----------------------------------------------------------------------
2bw2A           ----------------------------------------------------------------------
3cqhB           ----------------------------------------------------------------------
1aw5A           ----------------------------------------------------------------------
3cqjA           ----------------------------------------------------------------------
3bz6A           ----------------------------------------------------------------------
1dxiA           ----------------------------------------------------------------------
3cnyA           ----------------------------------------------------------------------
3c6cA           ----------------------------------------------------------------------
3c7wA           ----------------------------------------------------------------------
3dfuB           ----------------------------------------------------------------------
2dgmE           ----------------------------------------------------------------------
3e96B           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           IIAVVGCYAQIAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVKVGAVLKNKVFEDLKIEEYNN
3cl5A           VYNGSACKSGSLVLNAREANFGDYYYKVEALSGCDEYIVPLCIFNGKFLSNTKYYDDSQYYFNKDTGVIY
1clkA           KFTFGLWTVGWQGRDPFGD-------ATRGALDPAESVRRLAELGAHGVTFHDDDLIPFGATDSERAEHG
2btvB           ----------------------------------------------------------------------
3banB           -LEEIKAIPGMQGIVAVYDVPVGQAWPLENILELKKMVEEAGLEITVIESIPVHEDIKQGKPNRIENYKT
2d32D           RLSDLGYTNQSNLGIYEYVAGLKQAIKTPSEEYAKIGIEKDGKRLQINSNVLQIENELYAPIRPKRVTRS
2a5hA           LKKYIPLTKECVKSLRAITPYYLSLIDPNDPNDPVRKQAIPTALELNKAAADLEDPLHEDTDSPVPGLTH
2e7sB           ----------------------------------------------------------------------
3dntA           ----------------------------------------------------------------------
3cqiA           -------------------------------------LQLAKTLGFDFVEMS--VDETDERLSRLDWSRE
2e7sC           ----------------------------------------------------------------------
3ebjC           ----------------------------------------------------------------------
3cl4A           AQSTALCKSGSLVLNAREANFGDYYYKVEADFYLSGCDEYIVPLCIFNGKFLSNTDDSQYYFNKDTGVIY
2e7sK           ----------------------------------------------------------------------
2a5hB           LKKYIPLTKEEEEGVAAITPYYLSLIDPNDPNDPVRKQAIPTALELNKAAADLEDPLHEDTDSPVPGLTH
2e7sA           ----------------------------------------------------------------------
2e7sH           ----------------------------------------------------------------------
3cqjB           -------------------------------------LQLAKTLGFDFVEMS--VDETDERLSRLDWSRE
2e7sN           ----------------------------------------------------------------------
3cqhA           ----------------------------------------------------------------------
3chvA           ----------------------------------------------------------------------
2e7sG           ----------------------------------------------------------------------
3dtvA           ----------------------------------------------------------------------
3cqiB           -------------------------------------LQLAKTLGFDFVEMS--VDETDERLSRLDWSRE
3c8fA           ------------------------------------------------------VIGRIHSFESCGTVDG
3biyA           ----------------------------------------------------------------------
3cb8A           ------------------------------------------------------VIGRIHSFESCGTVDG
2cb6A           ----------------------------------------------------------------------
3e65A           --------------------------------------------------------------IKNWGSGE
3cixA           ----------------------------------------------------------------------
2e7sD           ----------------------------------------------------------------------
1eb3A           ---------------------------------------------------------------------N
3ciwA           ----------------------------------------------------------------------
3dx5A           ----------------------------------------------------------------------
3dcxA           ----------------------------------------------------------------------
2bw2A           ----------------------------------------------------------------------
3cqhB           ----------------------------------------------------------------------
1aw5A           ---------------------------------------------------------------------K
3cqjA           -----------------------------------------------------------------DWSRE
3bz6A           ----------------------------------------------------------------LGCLIE
1dxiA           ----------FGLWTVGWQGRDPFGDATRPALDPVETVQRLAELGAYGVTFH--DDDLIPFGSSDTERES
3cnyA           ----------------------------------------------------------------------
3c6cA           ----------------------------------------------------------------------
3c7wA           ----------------------------------------------------------------------
3dfuB           ----------------------------------------------------------------------
2dgmE           ----------------------------------------------------------------------
3e96B           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           KTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEIRSLAEHGFKEIILSGIHTASYGVDLDEKVT
3cl5A           GLNSTETITTGFDFNCHYLVLPSGNYL--AISNELLLTVPTKAICLNKRKDFTPVQVVDSRWNNARQSDN
1clkA           MKVPMATTNLFTHPVFKDGGFTANDRDVRRYALRKTIRNIDLAVELGAQTYVAWGGREGAESGAARMKEA
2btvB           ------------------------------------------------RPERIKTLEGDVLSSDSGPLLA
3banB           SIRNVGAAGIPVVCYNFMPVFDWTRSDLHHPLPDGSTSLAFLKSDLAGVDPVAIIENYRQNISEEDLWAN
2d32D           GESPSDALLRSLDINPFIGVDEQQVRFLDLFMVWCALADAPEMSSSELACTRVNWNRVILEGRKPGLTLG
2a5hA           RYPDRVLLLITDCSYCRHCTRRRFAGQSDDSPERIDKAIDYIRNTPQVRDVLLSGGDALLVSDE-----T
2e7sB           ------------------------------------------LEEQLNKSLKTIASQIENYNQLKEDYNT
3dntA           -APEWLASRYAR---PLSLSLPLQRGNITSDAVFNFFDN---LLPDSPIVRDRIVKRYHAKSRQP-----
3cqiA           QRLALVNAIVETGVRVPSMCLSAHRRFPLGSEDDAVRAQGLEIMRKAIQFAQDVGIRVIDVYYQEANNET
2e7sC           ------------------------------------------LEEQLNKSLKTIAKAIENYNQLKEDYNT
3ebjC           ----------------------------------------------------------------------
3cl4A           GLNSTETITTGFDFNCHYLVLP--SGNYLAISNELLLTVPTKAICLNKRKDFTPVQVVDSRWNNARQSDN
2e7sK           ------------------------------------------LEEQLNKSLKTIAAAIENYNQLKEDYNT
2a5hB           RYPDRVLLLITDCSYCRHCTRRRFAGQSDDSPERIDKAIDYIRNTPQVRDVLLSGGDALLVSDETLE---
2e7sA           ------------------------------------------LEEQLNKSLKTIAKAIENYNQLKEDYNT
2e7sH           ------------------------------------------LEEQLNKSLKTIAAAIENYNQLKEDYNT
3cqjB           QRLALVNAIVETGVRVPSMCLSAHRRFPLGSEDDAVRAQGLEIMRKAIQFAQDVGLAGYDVYYQEANNET
2e7sN           ------------------------------------------LEEQLNKSLKTIASAIENYNQLKEDYNT
3cqhA           --------TLGFDFVESVDETDE-RLSRLDWSREQRLALVNAIVETGVRVPSCLSAHRRFPLGSEDDAGL
3chvA           ---------KPCIICVAITGSVPTKADNPAVTVSEQVESTQEAFEAGAAIAHCHVRNDDGTPSSDPDR--
2e7sG           ------------------------------------------LEEQLNKSLKTIASQIENYNQLKEDYNT
3dtvA           --PAAGLVPADGARLYPDLPFASGLGEGYDAVIESVVDHARRLQKQGAAVVSLMGTSLSFYRGAAFNATT
3cqiB           QRLALVNAIVETGVRVPSMCLSAHRRFPLGSEDDAVRAQGLEIMRKAIQFAQDVGLAGYDVYYQEANNET
3c8fA           PGIRFITFFQGCLMRCLYCHNRDTWDTHGGKTVEDLMKEVVTYRHFMNASGGGVTASGGEAILQAEFV--
3biyA           ----FSAKRLPSTRLGTFLEVNDFLRRQNHPESGEVTVRVVHASDKTV-EVKPGMKARFVDSGEMESFPY
3cb8A           PGIRFITFFQGCLMRCLYCHNRDTWDTHGGKTVEDLMKEVVTYRHFMNASGGGVTASGGEAILQAEF---
2cb6A           -----------------DTHLLNYLRTNSPSIFVSTTRARYNNLGLEITPWTPHSANNNIIYRYEIFAPG
3e65A           ILHDTLHHKATSDFTSCLGSIMNRGPRDKPTPLEELLPHAIEFINQYYGSF--------KEAKIE-----
3cixA           --RAIIEFSNVCRKNCLYCGLRRDNKNLKRYTPEEIVERARLAVQFGAKTIVLQSGEDPYYMPDV-----
2e7sD           ---------------------------------EEQLNKSLKTIASQKAAIENYNQLKED----------
1eb3A           MLIFPLFISDNPDDFTE---IDSLPN-INRIGVNRLKDYLKPLVAKGLRSVILFGVPLIPGTKDPVGT-A
3ciwA           --RAIIEFSNVCRKNCLYCGLRRDNKNLKRYTPEEIVERARLAVQFGAKTIVLQSGEDPYMP--------
3dx5A           ---KTIEKCEQLAILANWFKTNKIRTFAGQKGSADFSQQERQEYVNRIRICELFAQHNYVLLETHPNTLT
3dcxA           ----------------------------------------------------------------------
2bw2A           -------VEHYEPLQVHVQLEKVYLDGDVSIKHEKVFSMDDFWAAYAGWTLVEQKKGYVLFRKQM-----
3cqhB           ----------GFDFVESVD--ETDERLSRLDWSREQRLALVNAIVETGVRVPSCLSAHRRFPLGSEDDAQ
1aw5A           NLIFPLFISDNPDDFTE---IDSAPN-INRIGVNRLKDYLKPLVAKGLRSVILFGVPLIPGTKDP-----
3cqjA           QRLALVNAIVETGVRVPSMCLSAHRRFPLGSEDDAVRAQGLEIMRKAIQFAQDVGIRVDVYYQEANNETR
3bz6A           KQATNETYPLTLNALVIACNQKTSRDPV-NLTQGQVGQSLRALEGRGLTRLVGSRADRWEHKVDLELVPA
1dxiA           HIKRFRQALDATGMTVPFTHPVFKDGGFTANDRRKTIGNIDLAAELGAKTYVAWGGREGAESGGAKDVRD
3cnyA           -------LKLRNLEIAGQWFSSYIIRDGIEKASEAFEKHCQYLKAINAPVAVVSEQTYTIQRSDTANIFK
3c6cA           ---------RKVILTCAVTGNAPFNPKHPSPTPAQIADACVEAAKAGASVAHIHVRDPKTGGGSRDPV-L
3c7wA           ----------------------------------------------------------------------
3dfuB           ---------IVSAHPIGQDRWVASALDELGETIVGLLVGELGGSIVEIADDKRAQLAAALTYAGFLQRDA
2dgmE           ---------------------------------KQVTDLRSELLDSRFGAKSISTIAESKRFPLHEMRDD
3e96B           -------------------------------DWHHYKETVDRIVDNGIDVIVPCGNTSEFYALSLEEAKE


                         .         .         .         +         .         .         .:280
query           LVDLLEEIEKIDGIERVRIGSIDPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYE
3cl5A           MTAVACQPPYCYFRNSTYVGVYDINHGDAGFTSILSGLLCFSQQGVFRYDNVSSVWPLYSYGRPTAAD--
1clkA           FDLLGEYVTSQGYDTPFAIEPKPNEPRGDILLPTIGHALAFIDGLERP-----ELYGVNPEVGHEQMAGL
2btvB           LQEIMQKVRQVQATREVDFTVPDVQQILDDI--KALAAEQVYKIVKVPSTSFRHIVTQSRDRVLRVDTYY
3banB           LEYFIKAILPTAEEAGVKMA-IHPDDPPYGIFGLPRIITGQEAVERFLNLYDSEHNGITMCVGSYASDPK
2d32D           IGCETAQFPLPQVGKDLRVAQTLDSINGGEAYQKVCD--ELVACFDNPDLTFSARILRSMIDTGIGGTGK
2a5hA           LEYIIAKLREIPHVEIVRIGSRTPVVLPQRIT---------PELVNLKKYHPVWLNTHFNHPNEITEEST
2e7sB           LKRELSDR--DDEVKRLREDIAKENELRTKAEEEADKLNKEVEDLTASLFDEANNLVADAREKYAIEILN
3dntA           ----FDLLSEIGRDSVGAVTLIPIAWEKLTEARLEEVLTAYKADIPLGIREE---NDFRISVAGAQEKTA
3cqiA           RRRFRDGLKESVEMASRAQVTLAMEIMDYPLMNSISKALGYAHYLNNPFQLYPDIGNLSAWDNDVQMELQ
2e7sC           LKRELSDR--DDEVKRLREDIAKENELRTKAEEEADKLNKEVEDLTASLFDEANNLVADAREKYAIEILN
3ebjC           LGSMEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCMYSHRFEIIEGRDRTMAWTVVN
3cl4A           MTAVACQPPYCYFRNSTYVGVYDINHGDAGFTSILSGLLYFSQQGVFRYDNVSSVWPLYSYGRPTAAD--
2e7sK           LKRELSDR--DDEVKRLREDIAKENELRTKAEEEADKLNKEVEDLTASLFDEANNLVADAREKYAIEILN
2a5hB           --YIIAKLREIPHVEIVRIGSRTPVVLPQRITPELVNLKKYHPVWL---------NTHFNHPNEITEEST
2e7sA           LKRELSDR--DDEVKRLREDIAKENELRTKAEEEADKLNKEVEDLTASLFDEANNLVADAREKYAIEILN
2e7sH           LKRELSDR--DDEVKRLREDIAKENELRTKAEEEADKLNKEVEDLTASLFDEANNLVADAREKYAIEILN
3cqjB           RRRFRDGLKESVEMASRAQVTLAMEIMDYPLMNSISKALGYAHYLNNPWFQLYPDIGNLSAWDNDQMELQ
2e7sN           LKRELSDR--DDEVKRLREDIAKENELRTKAEEEADKLNKEVEDLTASLFDEANNLVADAREKYAIEILN
3cqhA           EIRKAIQFAQDVGIRVIQLAGYDNNETRRRFRDGLKESVEASRAQVTLAEPWFQLYPDIGNLSAWVQELQ
3chvA           FARLTEGLHTHCPGIVQFSGQARGGLPLKPDASLSVGSPSRVYENPPDLVDWLAAQRSYRVTPEIEAFDL
2e7sG           LKRELSDR--DDEVKRLREDIAKENELRTKAEEEADKLNKEVEDLTASLFDEANNLVADAREKYAIEILN
3dtvA           MSTAVLNGLRALGVRRVALATAYIDDVNERLAAFLAEESLVPTGCRSLDTATLVDLCVRAFEAAGGLLTL
3cqiB           RRRFRDGLKESVEMASRAQVTLAMEIMDYPLMNSI------SKALGYAHYLNNPWFQLYPDIGNLSAWDN
3c8fA           -RDWFRACKKEGIHTCLDTNGFVR-----RYDPVIDELLEVTDLVMLDLKQMNDEIHQNLVGVSNHRTLE
3biyA           RTKALFAFEEIDGV-DLCFFGMHVQEYGSD-----------------------------CPPPNQRRVYI
3cb8A           VRDWFRACKKEGIHTCLD---TNGFVRRYDPVIDE--LLEVTDLVMLDLKQMNDEIHQNLVGVSNHRTLE
2cb6A           GIDINASFSRNHNPFPNQDEITFPGGIRPEFIRSTYEYHNGEVRIWINPNFINPSTLNDVSGPSNISKVF
3e65A           -----EHLARLEAVTKEIETTGTYQLTLDELIFATKMAWRNAPRCIGRIQWSNLQVFDARNCSTAQEMFQ
3cixA           ISDIVKEIKKMGVAVTLSLGEWPREYYEK-------WKEAGADRYLLRHETANPVLHRKLRPDTSFENRL
2e7sD           YNTLKRELSDDDEVKRLREDIAKENELRTKAEEEADKLNKEVEDLTASLFDEANNLVADAREKYAIEILN
1eb3A           ADDPAGPVIQGIKFIREYFPELYII---------------CDVCLCEYTSHGHCGVLYDDGTINRERSVS
3ciwA           -----DVISDIVKEIKKMGVAVTLSLGEWPREYYEKWKEAGADRYLLRHETANPVLHRKLRPDTSFENRL
3dx5A           LPSTLELLGEVDHPNKINLDFLHIWESGADPVDSFQQLRPWIQHYHFK----NISSADYLHVFEPNNVY-
3dcxA           ------------------------------------------------AEVNLDELAQELGPIGDNEQLA
2bw2A           ----DDISPLSKVNGYIGVSDNGVISTFHGRPEPASEP--IQSFFQIDLERLESHMQKNLLKGIPFRTKA
3cqhB           GLEIRKAIQFAQGIRVIQLAGYDVYYQEANNETRRRFRDGLKESVEAILNNPWFQLYPDIGNLSAVQELQ
1aw5A           -----------VGTAADDPAGPVIQGIRFIREKFPELYIICDVCLCEYTSHGHCGVLYDDGTINRERSVS
3cqjA           FRDGLKESVEMASRAQVTLAMEIMDYPLMNSISKALGYAHYLNNPWFQLYPDI--GNLSAWDNDVQMELQ
3bz6A           QVILTGLLLLRGPQTVSELLTR-SNRHDFEDSEQV--VHQLERLIARGLATLVPRQSGREDRYH------
1dxiA           FDLLGEYVTAQGYDLRFAIEPKPNEPRGDILLPTVGHALAFIERLERP-----ELYGVNPEVGHEQMAGL
3cnyA           DKPYFTDKEWAKYGLKVAYHHHGTGIQTKEETDRLANVGLLYDTGHIAVSDGDYALLNAHIDRVVHVHFK
3c6cA           FKEVVDRVRSSGTDIVLNLTCGLGAFLLPDPEDESKALPESDVVPVAERVKHLEDCLPEIASLDITTGN-
3c7wA           --------------------------------------------LNAAKSELDKAIGRNCNGVITKDEAE
3dfuB           SYFLDEFLGDPDVTSDIV--DSAQQFQALPSLDEVIAQY--DSINNPGRQRLFRDLARRQAEISRAQDIE
2dgmE           AFQIINDELYLDGNARQNLATFCQTWDDENVHKLMDLSINKNWIDKEESAAIDLRCVNMVADLWHAP---
3e96B           EVRRT--VEYVHGRALV-VAGIGY--ATSTAIELGNAAK-------------------------------


                         .         *         .         .         .         .         +:350
query           DIVNLLRDKIEDVSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRKGTRAENMENQVDGNK
3cl5A           ----------------------------------------------------------------------
1clkA           NFPHGIAQALWAGKLKYDQDLRFGPGDLRAAFWLVDLLESAGYEGPRHFDFKPPRTEDFDGVWASAAGCM
2btvB           EEMSQVGD-------------VITEDEPEKFYSTIIKKRFIRGKGSFILHDIPARDHRGMEVAEP-EVLG
3banB           NDVLAMTEHTRNVTAGAWGFQELSQAGDIDMNAVVKLLVDYDWQGSLRPDHGRRIWGDQTKTPGYGLYDR
2d32D           AFANLLREE-------------------------------------------------------------
2a5hA           RACQLLADAGVPLGNQSVLLRGVN--DCVHVKELVNKLVKIRVRPYYIYQCDLSLGLEHFRTPVSKGIEI
2e7sB           KRLTEQLREKDLLDTLT-----------------------------------------------------
3dntA           LLRIGNDWCIPKGITPTTHIIKLPIQSVDNEYYCLLLAKELGL-NVPDAEIIKAGNVRALAVE-RFDRRW
3cqiA           AGIGHIVAVHVKDTKPGVFKNVPFGEGVVDFERCFETLKQSGYCGPYLIEMWSETAEDPAAEVAKA----
2e7sC           KRLTEQLREKDLLDTLT-----------------------------------------------------
3ebjC           SICNTTGVLYDYKENRFIEIGVTRR---EVHTYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEES
3cl4A           ----------------------------------------------------------------------
2e7sK           KRLTEQLREKDLLD--------------------------------------------------------
2a5hB           RACQLLADAGVPLGNQSVLLRGVN--DCVHVKELVNKLVKIRVRPYYIYQCDLSLGLEHFRTPVSKGIEI
2e7sA           KRLTEQLREKDLL---------------------------------------------------------
2e7sH           KRLT------------------------------------------------------------------
3cqjB           AGIGHIVAVHVKDTKPGVFKNVPFGEGVVDFERCFETLKQSGYCGPYLIEWSETAEDPAAEVAKARDWVK
2e7sN           KRLTEQLREKD-----------------------------------------------------------
3cqhA           AGIGHIVAVHVKDTKPGVFKNVPFGEGVVDFERCFETLKQSGYCGPYLIEWSETAEDPAAEVAKARDWVK
3chvA           SHILRAIDHGRGLLYGKLYVQFVGVKNAPADREVFDFYVRRTRAPQAEWCAIGANQLTVNEWAIAAGGHT
2e7sG           KRLTQLREK-------------------------------------------------------------
3dtvA           DAIPEVERRLGVPVVSSSPAGFWD----------------------------------------------
3cqiB           DVQMELQAGIGHVKDTKPFKNVPFGEGVVDFERCFETLKQSGYCGPLIEMWSETAEDPAAEVAKAR----
3c8fA           FAKYLANKNVKVWIRYV--VVPGWSDDDDSAHRLGEFTRDMNVEKIELLPYHELGKHKWVAMGEEYKLDG
3biyA           SYLDSVHFFRPKCLRTAVYHEILIGYLEY--------VKKLGYTTGHIWACPPSEGDDYIFHQKIPKPKR
3cb8A           FAKYLANKNVK--VWIRYVVVPGWSDDDDSAHRLGEFTRDMNVEKIELLPYHELGKHKWVAMGEEYKLDG
2cb6A           WHENHSEGNNMD-SQDFDMFAPNGE---------------------------------------------
3e65A           HICRHILYATNNGNIRSAITVFPQ----------------------------------------------
3cixA           NLLTLKELGYETG---AGSMVGLPGQTIDDLVDDLLFLKEHDFDMVGIGPFIPHPDTPLANEKKGD----
2e7sD           KRLTEQL---------------------------------------------------------------
1eb3A           RLAAVAVNYAKHCVAPSDMIDGRI----------------------------------------------
3ciwA           NLLTLKELGY---ETGAGSMVGLPGQTIDDLVDDLLFLKEHDFDMVGIGPFIPHPDTPLANEKKGDTLTL
3dx5A           -------------AAAGNRTGVPLFEGIVNYDEIIQEVRDTDHFASEWFGHNAKDILKAEKV--------
3dcxA           LAYRVIRDFVFT-NKRLILIDKQGVTGKKVSYHSVPYKAHFEVETAGTFDDAELKLWISGQKDPLVKELK
2bw2A           EFEDVIEHMKT-----------------------------------------------------------
3cqhB           AGIGHIVAVHVKDTKPGVFKNVPFGEGVVDFERCFETLKQSGYCGPYLIEWSETAEDPAAEVAKARD---
1aw5A           RL--------------------------------------------------------------------
3cqjA           AGIGHIVAVHVKDTKPGVFKNVPFGEGVVDFERCFETLKQSGYCGPYLIEMWSETAEDPAAE--------
3bz6A           ----------------------------------------------------------------------
1dxiA           NFPHGIAQALWAGKLKYDQDLRFGAGDLRAAFWLVDLLETAGYEGPRHFDFKPPRTEDFDGVWASAAGCM
3cnyA           DVRRSKEEECRAKGLTFQGSFTVPGDGDLDFKPVYDKLIANNYKGWIVVEAEQDPSKANPLE--------
3c6cA           ----------------------------------------------------------------------
3c7wA           KLFNQDVDAAVGILRNAKLKPVYDSLDAVRKCALINMVFQMGETGVAGFTNSLRMLQQAVNLAKSRWYNQ
3dfuB           LW-AIQK---------------------------------------------------------------
2dgmE           ----------------------------------------------------------------------
3e96B           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           KDERSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGKILNVKI
3cl5A           ----------------------------------------------------------------------
1clkA           RKERAAAFRADPEVQEDELAQPTAGDGLQALLPDR-----------------------------------
2btvB           V-EFKNVLPVLTAEHRAMIQNALDGSIIENVATRDVDVFIGIYRIYNR------------LQGYIEAVQL
3banB           ALGATNGLYEAGKTPDFGIKAKTVG---------------------------------------------
2d32D           ----------------------------------------------------------------------
2a5hA           IEGLRGHTSGYCVPTFVVDAPGGGGKTPVPNYVI------------------------------------
2e7sB           ----------------------------------------------------------------------
3dntA           NAERTVLLRLPQEDCQTFGLPSSVKYESDGGPGIARIAFLGSLKDRYDFKFQVFQWLIGATQGHAKNFSV
3cqiA           ----------------------------------------------------------------------
2e7sC           ----------------------------------------------------------------------
3ebjC           RARIKTRLFTIRQEMASRGLWDSFRQS-------------------------------------------
3cl4A           ----------------------------------------------------------------------
2e7sK           ----------------------------------------------------------------------
2a5hB           IEGLRGHTSGYCVPTFVVDAPGGGGKTPVPNYVI------------------------------------
2e7sA           ----------------------------------------------------------------------
2e7sH           ----------------------------------------------------------------------
3cqjB           ARMA------------------------------------------------------------------
2e7sN           ----------------------------------------------------------------------
3cqhA           A---------------------------------------------------------------------
3chvA           RTGLEDNIRLDRQTLA-PSNAALVRRSVELCDKYQRPV--------------------------------
2e7sG           ----------------------------------------------------------------------
3dtvA           ----------------------------------------------------------------------
3cqiB           --DWVKARMAKAGM--------------------------------------------------------
3c8fA           VKPPKKETMER-----------------------------------------------------------
3biyA           LQEWYKKMLDKAVSERIVYKDIFKQATEDRLTS-------------------------------------
3cb8A           VKPPKKETMER-----------------------------------------------------------
2cb6A           ----------------------------------------------------------------------
3e65A           ----------------------------------------------------------------------
3cixA           -FTLTLKMVALTRILLPDTAMGTIVPGGREITLRCGANVIMPNWTPSPYRQLYQL---------------
2e7sD           ----------------------------------------------------------------------
1eb3A           ----------------------------------------------------------------------
3ciwA           KMVALTRILLPDSNIPATTAMGTIVPGGREITLRCGA-NVIMPNWTPSPYRQLYQLYPGKI---------
3dx5A           ----------------------------------------------------------------------
3dcxA           KGTDVVGI--------------------------------------------------------------
2bw2A           ----------------------------------------------------------------------
3cqhB           ----------------------------------------------------------------------
1aw5A           ----------------------------------------------------------------------
3cqjA           ----------------------------------------------------------------------
3bz6A           ----------------------------------------------------------------------
1dxiA           RKDRAAAFRA-----DPEVQEALRAARLDQL---------------------------------------
3cnyA           ----------------------------------------------------------------------
3c6cA           ----------------------------------------------------------------------
3c7wA           TPNRAKRVI--TTFRTGT----------------------------------------------------
3dfuB           ----------------------------------------------------------------------
2dgmE           ----------------------------------------------------------------------
3e96B           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           Nxxxxxxxxxxxxx
3cl5A           --------------
1clkA           --------------
2btvB           Q-------------
3banB           --------------
2d32D           --------------
2a5hA           --------------
2e7sB           --------------
3dntA           F-------------
3cqiA           --------------
2e7sC           --------------
3ebjC           --------------
3cl4A           --------------
2e7sK           --------------
2a5hB           --------------
2e7sA           --------------
2e7sH           --------------
3cqjB           --------------
2e7sN           --------------
3cqhA           --------------
3chvA           --------------
2e7sG           --------------
3dtvA           --------------
3cqiB           --------------
3c8fA           --------------
3biyA           --------------
3cb8A           --------------
2cb6A           --------------
3e65A           --------------
3cixA           --------------
2e7sD           --------------
1eb3A           --------------
3ciwA           --------------
3dx5A           --------------
3dcxA           --------------
2bw2A           --------------
3cqhB           --------------
1aw5A           --------------
3cqjA           --------------
3bz6A           --------------
1dxiA           --------------
3cnyA           --------------
3c6cA           --------------
3c7wA           --------------
3dfuB           --------------
2dgmE           --------------
3e96B           --------------