[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for cper0:BAB81831.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3e27A.bssp"
#ERROR : Can't open dsspfile "3dv2B.bssp"
#ERROR : Can't open dsspfile "3e27B.bssp"
#ERROR : Can't open dsspfile "3e27D.bssp"
#ERROR : Can't open dsspfile "3dv2A.bssp"
#ERROR : Can't open dsspfile "1ej2A.bssp"
#ERROR : Can't open dsspfile "3do8A.bssp"
#ERROR : Can't open dsspfile "2b7lA.bssp"
#ERROR : Can't open dsspfile "2b7lB.bssp"
#ERROR : Can't open dsspfile "3do8B.bssp"
#ERROR : Can't open dsspfile "1b6tA.bssp"
#ERROR : Can't open dsspfile "2ejcA.bssp"
#ERROR : Can't open dsspfile "3cowB.bssp"
#ERROR : Can't open dsspfile "1cozA.bssp"
#ERROR : Can't open dsspfile "3covB.bssp"
#ERROR : Can't open dsspfile "3cr8C.bssp"
#ERROR : Can't open dsspfile "3cr8B.bssp"
#ERROR : Can't open dsspfile "2a7xA.bssp"
#ERROR : Can't open dsspfile "2a86B.bssp"

## Summary of PDB Search
:202
    2e-30  39%  3e27A  [x.x.x] NICOTINATE (NICOTINAMIDE) NUCLEOTIDE
    2e-30  38%  3dv2B  [x.x.x] NICOTINATE (NICOTINAMIDE) NUCLEOTIDE
    4e-30  39%  3e27B  [x.x.x] NICOTINATE (NICOTINAMIDE) NUCLEOTIDE
    6e-29  39%  3e27D  [x.x.x] NICOTINATE (NICOTINAMIDE) NUCLEOTIDE
    9e-29  38%  3dv2A  [x.x.x] NICOTINATE (NICOTINAMIDE) NUCLEOTIDE
    8e-23  17%  1ej2A  [c.26.1] NICOTINAMIDE MONONUCLEOTIDE ADENYLYLTRANSFERASE
    8e-21  20%  3do8A  [x.x.x] PHOSPHOPANTETHEINE ADENYLYLTRANSFERASE
    2e-19  17%  2b7lA  [x.x.x] GLYCEROL-3-PHOSPHATE CYTIDYLYLTRANSFERASE
    6e-18  14%  2b7lB  [x.x.x] GLYCEROL-3-PHOSPHATE CYTIDYLYLTRANSFERASE
    7e-18  21%  3do8B  [x.x.x] PHOSPHOPANTETHEINE ADENYLYLTRANSFERASE
    1e-17  22%  1b6tA  [c.26.1] PROTEIN (PHOSPHOPANTETHEINE ADENYLYLTRANSFERASE)
    1e-17  14%  2ejcA  [x.x.x] PANTOATE--BETA-ALANINE LIGASE
    3e-16  11%  3cowB  [x.x.x] PANTOTHENATE SYNTHETASE
    5e-16  17%  1cozA  [c.26.1] PROTEIN (GLYCEROL-3-PHOSPHATE
    2e-13  11%  3covB  [x.x.x] PANTOTHENATE SYNTHETASE
    8e-09   4%  3cr8C  [x.x.x] SULFATE ADENYLYLTRANFERASE, ADENYLYLSULFATE
    7e-08   4%  3cr8B  [x.x.x] SULFATE ADENYLYLTRANFERASE, ADENYLYLSULFATE
    1e-04  16%  2a7xA  [x.x.x] PANTOATE-BETA-ALANINE LIGASE
    3e-04  13%  2a86B  [x.x.x] PANTOATE--BETA-ALANINE LIGASE
:202

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKKIGVFGGTFDPIHIGHIYIAYEAYKILELDEVIFMPAGNPPHKKWKDITDEIIRYEMVKKAIEPYSFF
3e27A           -RKIGIIGGTFDPPHYGHLLIANEVYHALNLEEVWFLPNQIPPHKQGRDITSVESRLQMLELATEAEEHF
3dv2B           -RKIGIIGGTFDPPHYGHLLIANEVYHALNLEEVWFLPNQIPPHKQGRNITSVESRLQMLELATEAEEHF
3e27B           MRKIGIIGGTFDPPHYGHLLIANEVYHALNLEEVWFLPNQIPPHKQGRDITSVESRLQMLELATEAEEHF
3e27D           -RKIGIIGGTFDPPHYGHLLIANEVYHALNLEEVWFLPNQIPPHKQGRDITSVESRLQMLELATEAEEHF
3dv2A           -RKIGIIGGTFDPPHYGHLLIANEVYHALNLEEVWFLPNQIPPHKQGRNITSVESRLQMLELATEAEEHF
1ej2A           ---RGLLVGRMQPFHRGHLQVIKSILEEV--DELIICIGSAQLSHSIRDPFTAGERVMMLTKALSENGIP
3do8A           ---KVALGGTFEPLHEGHKKLIDVAIKLGGRDITIGVTSDRMARARIRSVLPFAIRAENVKRYVMRKYGF
2b7lA           --KRVITYGTYDLLHYGHIELLRRAREMGDYLIVALSTDEFNQIKHKKSYYDYEQRKMMLESIRYVDLVI
2b7lB           --KRVITYGTYDLLHYGHIELLRRAREMGDYLIVALSTDEFNQIKHKKSYYDYEQRKMMLESIRYVDLVI
3do8B           -----ALGGTFEPLHEGHKKLIDVAIKLGGRDITIGVTSDRMARARIRSVLPFAIRAENVKRYVMRKYGF
1b6tA           --KRAIYPGTFDPITNGHIDIVTRATQM--FDHVILAIAASPSK---KPMFTLEERVALAQQATAHLGNV
2ejcA           -KKTIGFVPTMGYLHEGHLSLVRRARAENDVVVVSIFVNPTQFGPNEDYPRDFERDRKLLEKENVDCIFH
3cowB           -GRRVMLVPTMGALHEGHLALVRAAKR--VPGSVVVVSIFVNPMQAY--PRTPDDDLAQLRAEG------
1cozA           --KKVITYGTFDLLHWGHIKLLERAKQLGDYLVVAISTDEFNLQKQKKAYHSYEHRKLILE------TIR
3covB           TGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQPRTPDD------DLAQLRAEGVEIAF-
3cr8C           -WRRIIAWQARQPMHRAQYEFCLKSAI--ENEANLLLHPQVGGDI--TEAPAYFGLVRSFLAIRDRFPAA
3cr8B           GWRRIIAWQARQPMHRAQYEFCLKSAI--ENEANLLLHPQVGGDI--TEAPAYFGLVRSFLAIRDRFPAA
2a7xA           -----MLVPTMGALHEGHLALVRAAKRV--PGSVVVVSIFVNPMQF---GAGGDDDLAQLRAEGVEIAF-
2a86B           -RRVMLVP-TMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFRTPDD------DLAQLRAE-------


                         .         .         *         .         .         .         .:140
query           SINNYEIEKKGLSFTYETLRYLHESFKEVELYFITGADCLVNLNSWKNINEIFKFSNLVVFNRPGFDKND
3e27A           SICLEELSRKGPSYTYDTMLQLTKKYPDVQFHFIIGGDMVEYLPKWYNIEALLDLVTFVGVARPG-----
3dv2B           SICLEELSRKGPSYTYDTMLQLTKKYPDVQFHFIIGGDMVEYLPKWYNIEALLDLVTFVGVARPG-----
3e27B           SICLEELSRKGPSYTYDTMLQLTKKYPDVQFHFIIGGDMVEYLPKWYNIEALLDLVTFVGVARPGYKL--
3e27D           SICLEELSRKGPSYTYDTMLQLTKKYPDVQFHFIIGGDMVEYLPKWYNIEALLDLVTFVGVARPG-----
3dv2A           SICLEELSRKGPSYTYDTMLQLTKKYPDVQFHFIIGGDMVEYLPKWYNIEALLDLVTFVGVARPGYKL--
1ej2A           ASRYYIIPVQDIECNALWVGHIKMLTPPFDRVYSGNPLVQRLFSEDGYEVTAPPLFYRDR----------
3do8A           EPEIVKIT-----NPYGKTLDVDFEYLVVSPETYEMALKINQKREELGKRKIT-----------------
2b7lA           PEKGWGQKEDDVE-KFDVDVFVMGHDWEGEFDFLKDKCEVIYL---------------------------
2b7lB           PEKGWGQKEDDVEKFDVDVFVMGHDWEGEFDFLKDKCE--------------------------------
3do8B           EPEIVKIT-----NPYGKTLDVDFEYLVVSPETYEMALKINQKREELGKRKI------------------
1b6tA           EVV---------GFSDLMANFARNQHAT---VLIRGLRAVADFEYEMQLAHMNRHLMPELESVFLMPSKE
2ejcA           -PSVEEMYPPDFSTYVEETKLSKHLGRSRPGHFRGVCTVVTKLFNIVKPHRAY-------FGQKDAQQFR
3cowB           -VEIAFTPTTAAMYPDGLRTTVQPG------PLAAELEGGPRPTHFAGVLTVLKLLQIVRPDRVFFGEKD
1cozA           YVDEVIP----EKNWEQKKQDIIDHNID---VFVMGDDWEGKFDFLKDQCEVVYLPRTEG----------
3covB           ------TPTTAAMYPDGLRTTVQPGPLAAELEGGPRPT---HFAGVLTVVLKLLQIVRPDRVFFGEKQQL
3cr8C           TT--------------------------------------------------------------------
3cr8B           TT--------------------------------------------------------------------
2a7xA           -------------TPTTAAMYPDGLRTTV------QPGPLAAELEGGPRPTHFKLLQIVRPDRVFFGEKD
2a86B           GVEIAFTPTTAAMYPDGLRTTV-------------QPGPLAAELEGGPRPTHFKLLQIVRPDRVFFGEKD


                         +         .         .         .         .         *         .:210
query           LLKRKEEFDREYCTNIVYLDLLNIEISSTLIRERVRESLEVKFFLPPGVVDIIDKYNLYRRx
3e27A           -------YKLRTPYPITTVEIPEFAVSSSLLRERYKEKKTCKYLLPEKVQVYIERNGLYE--
3dv2B           -------YKLRTPYPITTVEIPEFAVSSSLLRERYKEKKTCKYLLPEKVQVYIERNGLYE--
3e27B           ----------RTPYPITTVEIPEFAVSSSLLRERYKEKKTCKYLLPEKVQVYIERNGLY---
3e27D           -------YKLRTPYPITTVEIPEFAVSSSLLRERYKEKKTCKYLLPEKVQVYIERNGLY---
3dv2A           ----------RTPYPITTVEIPEFAVSSSLLRERYKEKKTCKYLLPEKVQVYIERNGLY---
1ej2A           -------------------------YSGTEVRRRMLDDGDWRSLLPESVVEVIDEINGVER-
3do8A           ------------------IVKVDWMMSSTRIKRGEID-------------------------
2b7lA           --------------------------------------------------------------
2b7lB           --------------------------------------------------------------
3do8B           --------------------------------------------------------------
1b6tA           WSF----------------------ISSSLVKEVARHQGDVTHFLPENVHQALMAK------
2ejcA           VLRRDLNMDVEMIECPIVREPDGLAMSSRNVYLSPEERQQALSLYQ----------------
3cowB           -----------------------YQQLVLIRQLVADFNLDVAVVGVPTVRE-----------
1cozA           --------------------------------------------------------------
3covB           VLIRQLVADFNLDVAVVGVPTVDGLAMSSRNR------------------------------
3cr8C           --------------------------------------------------------------
3cr8B           --------------------------------------------------------------
2a7xA           VLIRQLVADFNLDVAVVVREADGLAMSSRNRY------------------------------
2a86B           LIRQLVA-DFNLDVAVVVREADGLAMSSRNRY------------------------------