[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for cper0:BAB81882.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3egjA.bssp"
#ERROR : Can't open dsspfile "3dugC.bssp"
#ERROR : Can't open dsspfile "3dugA.bssp"
#ERROR : Can't open dsspfile "3be7B.bssp"
#ERROR : Can't open dsspfile "3be7C.bssp"
#ERROR : Can't open dsspfile "3dc8B.bssp"
#ERROR : Can't open dsspfile "2aqvB.bssp"
#ERROR : Can't open dsspfile "2aqoA.bssp"
#ERROR : Can't open dsspfile "1e9yB.bssp"
#ERROR : Can't open dsspfile "3egjB.bssp"
#ERROR : Can't open dsspfile "3be7A.bssp"
#ERROR : Can't open dsspfile "1a5kC.bssp"
#ERROR : Can't open dsspfile "3dc8A.bssp"
#ERROR : Can't open dsspfile "1ejsC.bssp"
#ERROR : Can't open dsspfile "1ejxC.bssp"
#ERROR : Can't open dsspfile "1ejtC.bssp"
#ERROR : Can't open dsspfile "1ejwC.bssp"
#ERROR : Can't open dsspfile "2bb0A.bssp"
#ERROR : Can't open dsspfile "1ejrC.bssp"
#ERROR : Can't open dsspfile "2aqvA.bssp"
#ERROR : Can't open dsspfile "1a5oC.bssp"
#ERROR : Can't open dsspfile "1ejuC.bssp"
#ERROR : Can't open dsspfile "2aqoB.bssp"
#ERROR : Can't open dsspfile "1a5nC.bssp"
#ERROR : Can't open dsspfile "3e0lA.bssp"
#ERROR : Can't open dsspfile "3e74B.bssp"
#ERROR : Can't open dsspfile "3e74A.bssp"
#ERROR : Can't open dsspfile "1e9zB.bssp"
#ERROR : Can't open dsspfile "1a5mC.bssp"
#ERROR : Can't open dsspfile "3e74C.bssp"
#ERROR : Can't open dsspfile "3d6nA.bssp"
#ERROR : Can't open dsspfile "2amxB.bssp"
#ERROR : Can't open dsspfile "1cr5C.bssp"
#ERROR : Can't open dsspfile "1cr5A.bssp"
#ERROR : Can't open dsspfile "1cr5B.bssp"
#ERROR : Can't open dsspfile "3c86A.bssp"
#ERROR : Can't open dsspfile "2d2gA.bssp"
#ERROR : Can't open dsspfile "1a4mA.bssp"
#ERROR : Can't open dsspfile "3e3hA.bssp"
#ERROR : Can't open dsspfile "1a5lC.bssp"
#ERROR : Can't open dsspfile "2a3lA.bssp"
#ERROR : Can't open dsspfile "2amxA.bssp"
#ERROR : Can't open dsspfile "3e2vB.bssp"
#ERROR : Can't open dsspfile "2eg6B.bssp"
#ERROR : Can't open dsspfile "3e2vA.bssp"
#ERROR : Can't open dsspfile "1bf6A.bssp"
#ERROR : Can't open dsspfile "1dpmA.bssp"

## Summary of PDB Search
:378
    1e-45  35%  3egjA  [x.x.x] N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE
    2e-45  17%  3dugC  [x.x.x] ZN-DEPENDENT ARGININE CARBOXYPEPTIDASE
    8e-43  17%  3dugA  [x.x.x] ZN-DEPENDENT ARGININE CARBOXYPEPTIDASE
    1e-42  18%  3be7B  [x.x.x] ZN-DEPENDENT ARGININE CARBOXYPEPTIDASE
    2e-42  15%  3be7C  [x.x.x] ZN-DEPENDENT ARGININE CARBOXYPEPTIDASE
    6e-41  16%  3dc8B  [x.x.x] DIHYDROPYRIMIDINASE
    2e-40  17%  2aqvB  [x.x.x] ISOASPARTYL DIPEPTIDASE
    2e-39  19%  2aqoA  [x.x.x] ISOASPARTYL DIPEPTIDASE
    3e-39  15%  1e9yB  [b.92.1 - c.1.9] UREASE BETA SUBUNIT
    5e-39  37%  3egjB  [x.x.x] N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE
    1e-38  17%  3be7A  [x.x.x] ZN-DEPENDENT ARGININE CARBOXYPEPTIDASE
    5e-38  16%  1a5kC  [b.92.1 - c.1.9] UREASE (ALPHA SUBUNIT)
    1e-37  16%  3dc8A  [x.x.x] DIHYDROPYRIMIDINASE
    1e-37  16%  1ejsC  [b.92.1 - c.1.9] UREASE ALPHA SUBUNIT
    8e-37  16%  1ejxC  [b.92.1 - c.1.9] UREASE ALPHA SUBUNIT
    1e-36  16%  1ejtC  [b.92.1 - c.1.9] UREASE ALPHA SUBUNIT
    2e-36  16%  1ejwC  [b.92.1 - c.1.9] UREASE ALPHA SUBUNIT
    2e-36  13%  2bb0A  [x.x.x] IMIDAZOLONEPROPIONASE
    2e-36  17%  1ejrC  [b.92.1 - c.1.9] UREASE ALPHA SUBUNIT
    2e-36  18%  2aqvA  [x.x.x] ISOASPARTYL DIPEPTIDASE
    4e-36  16%  1a5oC  [b.92.1 - c.1.9] UREASE (ALPHA SUBUNIT)
    9e-36  17%  1ejuC  [b.92.1 - c.1.9] UREASE ALPHA SUBUNIT
    4e-35  16%  2aqoB  [x.x.x] ISOASPARTYL DIPEPTIDASE
    3e-34  17%  1a5nC  [b.92.1 - c.1.9] UREASE (ALPHA SUBUNIT)
    5e-34  13%  3e0lA  [x.x.x] GUANINE DEAMINASE
    8e-34  13%  3e74B  [x.x.x] ALLANTOINASE
    7e-33  13%  3e74A  [x.x.x] ALLANTOINASE
    4e-32  17%  1e9zB  [b.92.1 - c.1.9] UREASE BETA SUBUNIT
    2e-30  15%  1a5mC  [b.92.1 - c.1.9] UREASE (ALPHA SUBUNIT)
    2e-29  13%  3e74C  [x.x.x] ALLANTOINASE
    2e-29  20%  3d6nA  [x.x.x] DIHYDROOROTASE
    6e-21   9%  2amxB  [x.x.x] ADENOSINE DEAMINASE
    1e-18  14%  1cr5C  [b.52.2 - d.31.1] SEC18P (RESIDUES 22 - 210)
    2e-18  13%  1cr5A  [b.52.2 - d.31.1] SEC18P (RESIDUES 22 - 210)
    2e-17  13%  1cr5B  [b.52.2 - d.31.1] SEC18P (RESIDUES 22 - 210)
    1e-14  13%  3c86A  [x.x.x] PHOSPHOTRIESTERASE
    2e-14  12%  2d2gA  [x.x.x] PHOSPHOTRIESTERASE
    2e-13  16%  1a4mA  [c.1.9] ADENOSINE DEAMINASE
    2e-13  11%  3e3hA  [x.x.x] PARATHION HYDROLASE
    8e-13  29%  1a5lC  [b.92.1 - c.1.9] UREASE (ALPHA SUBUNIT)
    3e-12   6%  2a3lA  [x.x.x] AMP DEAMINASE
    7e-12  10%  2amxA  [x.x.x] ADENOSINE DEAMINASE
    2e-11   8%  3e2vB  [x.x.x] 3'-5'-EXONUCLEASE
    3e-10  11%  2eg6B  [x.x.x] DIHYDROOROTASE
    2e-09   7%  3e2vA  [x.x.x] 3'-5'-EXONUCLEASE
    8e-08  10%  1bf6A  [c.1.9] PHOSPHOTRIESTERASE HOMOLOGY PROTEIN
    2e-05  10%  1dpmA  [c.1.9] PHOSPHOTRIESTERASE
:378

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MLIKNCNIVYLDKIEKGNILIENGKIKAINPKEECDCEVIDGEGLFLSPGFIDVHIHGAGGHDTMDGTYE
3egjA           -ALTNCKIYTGNDLVKHAVIINGDKIEAVCPIESLEMNVVDLNGANLSPGFIDLQLNGCGGVMFNDEITA
3dugC           FLIKSKGYLDIQEIIKADLLIRNGKIAEIGKINTKDATVISIPDLILIPGLMDSHVHIVGNDSKGEESIA
3dugA           FLIKSKGYLDIQEIIKADLLIRNGKIAEIGKINTKDATVISIPDLILIPGLMDSHVHIVGNDSKGEESIA
3be7B           FLIKSKGYLDIQEIIKADLLIRNGKIAEIGKINTKDATVISIPDLILIPGLMDSHVHIVGNDSKGEESIA
3be7C           FLIKSKGYLDIQEIIKADLLIRNGKIAEIGKINTKDATVISIPDLILIPGLMDSHVHIVGNDSKGEESIA
3dc8B           -VIKGGTIVTADLTYKADVKVEGGRIVEIGPNLSGA-ETLDATGCYVMPGGIDPHTHLEMPFMGTYS-SD
2aqvB           -LLQGAHLYAPEDRGICDVLVANGKIIAVPSDIVPNCTVVDLSGQILCPGFIDQHVHLIGGGGEAGPTTR
2aqoA           -LLQGAHLYAPEDRGICDVLVANGKIIAVPSDIVPNCTVVDLSGQILCPGFIDQHVHLIGGGGQAGPTTR
1e9yB           LIITNALIVDYTGIYKGNKDMQDGVKNNLSVGP--ATEALAGEGLIVTAGGIDTHIHFISPQQIPTAFAS
3egjB           -ALTNCKIYTGNDLVKHAVIINGDKIEAVCPIESLEMNVVDLNGANLSPGFIDLQLNGCGGVMFNDEITE
3be7A           -LIKSKGYLDIQEIIKADLLIRNGKIAEIGKINTKDATVISIPDLILIPGLMDSHVHIVGNDSKGEESIA
1a5kC           LVLTNALIVDHWGIVKADIGVKDGRIFAIGKAGNPDTEVIAAEGKIVTAGGIDTHIHWICPQQAEEALVS
3dc8A           -VIKGGTIVTADLTYKADVKVEGGRIVEIGPNLSGA-ETLDATGCYVMPGGIDPHTHLEMPFMGTYS-SD
1ejsC           LVLTNALIVDHWGIVKADIGVKDGRIFAIGKAGNPDTEVIAAEGKIVTAGGIDTHIHWICPQQAEEALVS
1ejxC           LVLTNALIVDHWGIVKADIGVKDGRIFAIGKAGNPDTEVIAAEGKIVTAGGIDTHIHWICPQQAEEALVS
1ejtC           LVLTNALIVDHWGIVKADIGVKDGRIFAIGKAGNPDTEVIAAEGKIVTAGGIDTHIHWICPQQAEEALVS
1ejwC           LVLTNALIVDHWGIVKADIGVKDGRIFAIGKAGNPDTEVIAAEGKIVTAGGIDTHIHWICPQQAEEALVS
2bb0A           -PRAGKSMQDLHVIEDAVVGIHEQKIVFAAEAGYEADEIIDCSGRLVTPGLVDPHTHLVFGGSREKEMNL
1ejrC           LVLTNALIVDHWGIVKADIGVKDGRIFAIGKAGNPDTEVIAAEGKIVTAGGIDTHIHWICPQQAEEALVS
2aqvA           -LLQGAHLYAPEDRGICDVLVANGKIIAVPSDIVPNCTVVDLSGQILCPGFIDQHVHLIGGGGEAGPTTR
1a5oC           LVLTNALIVDHWGIVKADIGVKDGRIFAIGKAGNPDTEVIAAEGKIVTAGGIDTHIHWICPQQAEEALVS
1ejuC           LVLTNALIVDHWGIVKADIGVKDGRIFAIGKAGNPDTEVIAAEGKIVTAGGIDTHIHWICPQQAEEALVS
2aqoB           -LLQGAHLYAPEDRGICDVLVANGKIIAVPSDIVPNCTVVDLSGQILCPGFIDQHVHLIGGGGQAGPTTR
1a5nC           LVLTNALIVDHWGIVKADIGVKDGRIFAIGKAGNPDTEVIAAEGKIVTAGGIDTHIHWICPQQAEEALVS
3e0lA           -IFRGTFVHSTWTCPMELGVSDSGKIVFLEEASQQEEIRELSHHEFFMPGLVDTHIHASQYSFAGSSIDL
3e74B           LIIKNGTVILENEARVVDIAVKGGKIAAIGQ--DLGDAKEVDASGLVVSPGVDAHTHISHWEGYETGTRA
3e74A           LIIKNGTVILENEARVVDIAVKGGKIAAIGQ-DLGDAKEVDASGLVVSPGVDAHT------HIGYETGTR
1e9zB           --ITNALIVDYTGIYKGNKDMQDGVKNNLSVGP--ATEALAGEGLIVTAGGIDTHIHFISPQQIPTAFAS
1a5mC           LVLTNALIVDHWGIVKADIGVKDGRIFAIGKAGNAATEVIAAEGKIVTAGGIDTHIHWICPQQAEEALVS
3e74C           LIIKNGTVILENEARVVDIAVKGGKIAAIGQ--DLGDAKEVDASGLVVSPGVDAHTHIYETGTRAAAKGG
3d6nA           LIVKNGYVIDPSLEGEFDILVENGKIKKIDKNILPEAEIIDAKGLIVCPGFIDIHVHLRDPGQTY---KE
2amxB           -------------RGSEIKFLKKEDVQNIDL--NGMSKKERYEIWRRIPK-VELHCHL-DLTFSAEFFLK
1cr5C           --LANVAAVPNDFPNNIYIIIDNLFVFTTRHSNDIPP---------GTIGFNGNQRTWGGWSLNQDVQ--
1cr5A           YALANVAAVSPNDFPNNIIIIDNLFVFTTRH---------SNDIPPGTIGFNGNQRTWGGWSLNQDVQAK
1cr5B           YALANVAAVSNDFPNNIYIIIDNLFVFTTRHSNDIP------------PGTIGFNGNQRTWGGWSLNQ-D
3c86A           -------------------------------------NTVRGPIPVSEAGFTLTHEHWPEFFGSRKALAE
2d2gA           -------------------------------------NTVRGPIPVSEAGFTLTHEHICGSFGSRKALAE
1a4mA           -PAFNKPKVELHAIKPETILYFGKKRGIALPADTVLRNIIGMDKPLSLPGFLAKFDYMPVIAGCREAIKR
3e3hA           -------------------------------------NTVRGPITISEAGFTLTHEHICGSSAGFLGSRK
1a5lC           LVLTNALIVDHWGIVKADIGVKDGRIFAIGKAGNAATEVIAAEGKIVTAGGIDTHIHWICPQQAEEALVS
2a3lA           ----------------------------------------------------------------------
2amxA           ------------------SEIKFLKKEDVQNIDLNGMSKKERYEIWRRIPKVELHCHLDLTFSAEFFLKW
3e2vB           --------------------------------------------------YYDIGLNFHGIYNGKQYHPA
2eg6B           -------------------------------------------QVLKIRRPDDWHLH-LRDGDMLKTVVP
3e2vA           --------------------------------------------------YYDIGLNFHGIYNGKQYHPA
1bf6A           ----------------------------------------------TGYTLAHEHLHFKNNVDCRLDQYA
1dpmA           -------------------------------------NTVRGPITISEAGFTLTHEHFLRAWPEFFGSRK


                         .         .         *         .         .         .         .:140
query           AINEISKVIVKHGTTSFLPTTMTVAAEDVCKSMEAIHKAKTEGTDGANVLGAHLEGPFISTSAIGAQNPD
3egjA           ETIDMHKANLKSGCTSFLPTLITSSDENMRQAIAAAREYQAKY--PNQSLGLHLEGPYLNVMKKGIHSVD
3dugC           DSSHMGTVWGVVNAEKTLMAGFTTVRNVGAANYADV--SVRDAIERGVINGPTMLVSGPALGITGGHCDH
3dugA           DSSHMGTVWGVVNAEKTLMAGFTTVRNVG--AANYADVSVRDAIERGVINGPTMLVSGPALGITGGHCDH
3be7B           DSSHMGTVWGVVNAEKTLMAGFTTVRNVGA--ANYADVSVRDAIERGVINGPTMLVSGPALGITGGHCDH
3be7C           DSSHMGTVWGVVNAEKTLMAGFTTVRNVGAA--NYADVSVRDAIERGVINGPTMLVSGPALGITGGHCDH
3dc8B           DFESGTRAALAGGTTMVVDFALPSGQSLLEALTMWDNKSTRANCDYSFHMAITWWGEQVFNEMETIVKDK
2aqvB           TPEVALSRLTEAGVTSVVGLLGTDSISRHPESLLAKTRA-------------------------LNEEGI
2aqoA           TPEVALSRLTEAGVTSVVGLLGTDSISRHPESLLAKTRA------------LNEEGISAWMLTGAYHVPS
1e9yB           GVTTMIGGGT-GPADGTNATTITPGRRNLKWMLRAAEEYSMNLGFLAKGNASNDASLADQIEAGAIGFIH
3egjB           TIDTMHKANLKSGCTSFLPTLITSSDENMRQAIAAAREYQAKY--PNQSLGLHLEGPDDTMIDTICANSD
3be7A           DSSHMGTVWGVVNAEKTLMAGFTTVRNVGAANYADVSVR--DAIERGVINGPTMLVSGPALGITGGHCDH
1a5kC           GVTTMGPAAGTHATTCTPPWYISRMLQAADSLPVNIG-----LLGKGNVSQPDALREQVAAGVIGLEIHE
3dc8A           DFESGTRAALAGGTTMVVDFALPSGQSLLEALTMWDNKSTRANCDYSFHMAITWWGEQVFNEMETIVKDK
1ejsC           GVTTMGPAAGTHATTCTPPWYISRMLQAADSLPVNIGLLGKGNVSQPDALREQVAAGVIGLINEDWGATP
1ejxC           GVT----TMVGGGTGPAAGTHATTCTPGPWYISRMLQAADSLPVNIGLLGKGNVSQPDALREQVAAGVIG
1ejtC           GVT----TMVGGGTGPAAGTHATTCTPGPWYISRMLQAADSLPVNIGKGNVSQPDALREQVAAGVIGLIQ
1ejwC           GVTTMGPAAGTHATTCTPPWYISRMLQAADSLPVNIGLLGKGNVSQPDALREQVAAGVIGLIHEDWGATP
2bb0A           KLQGISYLDILAQGGGILSTVKDTRAASEEELLQKAHFHLQRMLSYTTAEVKSGYGLEKETELKQLRVAK
1ejrC           GVT----TMVGGGTGPAAGTHATTCTP----GPWYISRMLQAADSLPVNIGLLGKGNVSQPDALREQVAA
2aqvA           TPEVALSRLTEAGVTSVVGLLGTDSISRHPESLLAKTRALNE----EGISAWMLTGAFHVPSR-------
1a5oC           GVTTMGPAAGTHATTCTPPWYISRMLQAADSLPVNIG-----LLGKGNVSQPDALREQVAAGVIGLCIHE
1ejuC           GVTTMGPAAGTHATTCTPPWYISRMLQAADSLPVNIG-----LLGKGNVSQPDALREQVAAGVIGLIHED
2aqoB           TPEVALSRLTEAGVTSVVGLLGTDSISRHPESLLAKTRA-----------------------LNEEGISA
1a5nC           GVT----TMVGGGTGPAAGTHATTCTP----GPWYISRMLQAADSLPVNIGLLGKGNVSQPDALREQVAA
3e0lA           PLLEWLTKYTFPAEHRFQNIDFAEEVYTR----VVRRTLKNGTTTACYFATIHTDSSLLLADITDKFGQR
3e74B           AAKGGI-----TTIEPLNQLPATVDRASIELKFDAAKGKLTIDAAQLGGLVSYNIDRLHELDEVGVVFCF
3e74A           AAAKGGITTIEPLNQLPATVDRASIELKF---DAAKGKLTIDAAQLGGLVSYNIDRLHELDEVGVVGFCF
1e9zB           GVTTMIGGGT-GPADGTNATTITPGRRNLKWMLRAAEEYSMNLLAKGNASNDASLADQIEAGAIGFIHED
1a5mC           GVTTMGPAAGTHATTCTPPWYISRMLQAADSLPVNIGLLGKGNVSQPDALREQVAAGVIGLAIHEDWGAT
3e74C           ITTIEPLNQLPATVDRASIELKFDAAKGKLTIDAAQLGGLVS----------YNIDRLHELDEVGVVGFC
3d6nA           DIESGSRCAVAGGFTTIVCMPNTNPPIDNTTVNYILQKSKSVGLCRVLPTGTITKGADFYSLKEAGCVAF
2amxB           WARKYNLQPNMSDDEILDHYLFTKEGKSLAEFIRVSDLYRDYDFIEDLAKGVVLMEFRYSPTFVSSSYGL
1cr5C           --AKAFDLFKYSGKQSYLGSIDIDISFRVFDQDELAKQFVRQIFSPTQYLIMEFQGHFFDLKIRNVQAID
1cr5A           AF----DLFKYSGKQSYLGSIDIDISFRAVFDQDELAKQFVRCYEPTQYLIMEFQGHFFDLKIRNVQAID
1cr5B           VQAKAFDLFKYSGKQSYLGSIDIDISFQDELAKQFVRCYESQIFSPTQYLIMEFQGHFFDLKIRNVQAID
3c86A           KAVRGLRHARAAGVQTIVDVSTFDIGRDVRLLAEVSRAA---DVHIVAATGLWFDPPLSMRMRSVEELTQ
2d2gA           KAVRGLRHARAAGVQTIVDVSTFDIGRDVRLLAEVSRAA---DVHIVAATGLWFDPPLSMRMRSVEELTQ
1a4mA           IAYEFVEMKAKEGVVYVEYSPHLLANSKVDPMPWNQTEGDVTPDDVVDLVNQGLQEGFGIKVRSILCCMR
3e3hA           ALAEKAVRGLRRARAAGVRTVDVSTFDIGRDVSLLAEVSRAADVHIVAATGLWFDPPLSMRLRSVEELTQ
1a5lC           GV--------------------------------------------------------------------
2a3lA           ----------------------------------------------------------------------
2amxA           A-RKYNLQPNMSDDEILDHYLFTKSVSDLYRDYDFIEDLAKWAVIEKYKEGVVLMEFRYSPTFVSSSYGL
3e2vB           DYVKLLERAAQRHVKNAL--VTGSSIAESQSAIELVSSVKDLSPLKLYHIGVHPCCVNEFAEAYNESLYA
2eg6B           YTSEYGRAIVMPNLAP--PVTTVEAAVAYRQRILDAVPAGHDCYLTDSLDPNELERGFNEGVFTAALYPA
3e2vA           DYVKLLERAAQRHVKNAL--VTGSSIAESQSAIELVSSKDLSPLKLYHTIGVHPCCVNEFAEAYNESLYA
1bf6A           FICQEMNDLMTRGVRNVIEMTNRYMGRNAQFMLDVMRETGINVVACTGYYQDA--FFPEHVATRSVQELA
1dpmA           ALAEKAVRGLRRARAAGVRTIVDVSTFDIGRDVSLLAEVSRAADVHIVAATGLWFDPPLSMRLRSVEELT


                         +         .         .         .         .         *         .:210
query           FLIPPTKENFYKLVGEHEDDVVSITLAPEVEGAKELTKFLSEKGIVVSMGHTKATYEEAMEGIKCGCSHA
3egjA           FIRPSDDT-MIDTICANSDVIAKVTLAPENNKP-EHIEKLVKAGIVVSIGHTNATYSEARKSFESGITFA
3dugC           NLLPPEFNYSSEGVKMVRKNRKYGADLIFCATGGVMSRNTDVNAKQFTLEEMKAIVDEAHNHGMKVAAHA
3dugA           NLLPPEFNSPWEARKMVRKNRKYGADLIFCATGGVMSRNTDVNAKQFTLEEMKAIVDEAHNHGMKVAAHA
3be7B           NLLPPEFNYSSEGVVDSPWEARKMVRKNRKYGADLIKFCATGNAKQFTLEEMKAIVDEAHNHGMKVAAHA
3be7C           NLLPPEFNYSSE-----GVVDSPWEARKMVRKNRKYGADLIKFCATGGVMSRNTDVNAKQFTLEEMKAIV
3dc8B           GINTFHFMAYKGALMVDDDEMFSSVHAENGDVVAQLQAKLLAEGNSGPEAHAYSRPAEVEGDMAGCPVYI
2aqvB           SAWMLTGAFHVPSRTITGSVEKDVAIIDRVIGVCAISDHRSAAPDVYHLANMAAESRVGGLLGGKPGVTV
2aqoA           RTITGSVEKDVAIIDRVIGVCAISDHRS-------------AAPDVYHLANMAAESRVGGLLGGKPGVTV
1e9yB           EDWGTTPSAINHAVADKYDVQVAIHTDTLNEAGCVEDTMAAIAGRTMHTFHTEGAGGGHAPDIIKVAGEH
3egjB           VIAKVTLAPENNKPEHIEKLVK--------------------AGIVVSIGHTNATYSEARKSFESGITFA
3be7A           NLLPPEFNYSSEG--VVDSPWEARKMVRKNRKYGADLIKFCATGGVMSRNTDVNAKQFTLEEMKAIVDEA
1a5kC           DWGATPAAEMDIQVALHSDTLNESGFVEDTLAAIGGRTIHTFHTEGAGGGHAPDIITACAHPNILPSSTN
3dc8A           GINTFHFMAYKGALMVDDDGALPLVHAENGDVVAQLQAKLLAEGNSGPEAHAYSRPAEVEGEAANRAIMI
1ejsC           AAIDCALTEMDIQVALHSDTLNESGFVEDTLAAIGGRTIHTFHTEGAGGGHAPDIITACAHPNILPSSTN
1ejxC           LIHEDW---------GATPAA----IDCALTVADEMDIQVALHSDTLNESGFVEDTLAAIGGRTIHTFHT
1ejtC           EDWGATPAAIDCAVALHSDTLNESGFVEDTLAAIGGRTIHTFHTEGAGGGHAPDIITACAHPNILPSSTN
1ejwC           AAIDCALTEMDIQVALHSDTLNESGFVEDTLAAIGGRTIHTFHTEGAGGGHAPDIITACAHPNILPSSTN
2bb0A           KLHESQPVDLVSTFGAHAIPPEYQNDPDDFLDQMLSLLPEIKEQELASFADIFTETGVFTVSQSRRYLQK
1ejrC           GVIGLIHEAWGATPAA---------IDCALTVADEMDIQVALHSDTLNESGFVEDTLAAIGGRTIHTFHT
2aqvA           --------------TITGSVEKDVAIIDRVIGVCAISDHRSAAPDVYHLANMAAESRVGGLLGGKPGVTV
1a5oC           DWGATPAAEMDIQVALHSDTLNESGFVEDTLAAIGGRTIHTFHTEGAGGGHAPDIITACAHPNILPSSTN
1ejuC           WGATPA------------------AIDCALTVADEMDIQVALHSDTLNESGFVEDTLAAIGGRTIHTFHT
2aqoB           WMLTGAYHVPSR--TITGSVEKDVAIIDRVIGVCAISDHRSAAPDVYHLANMAAESRVGGLLGGKPGVTV
1a5nC           GVIGLAIHEDWGATPAAIDCALTV--------ADEMDIQVALHSDTLNESGFVEDTLAAIGGRTIHTFHT
3e0lA           AFVGKVCMDLNDTFPEYKEPIVTPGNGVSETLMGELGNIAKTRDLHIQSHISENRDEVEAKNLYPSYKNY
3e74B           VRDVNDWQFFKGAQKLGELGQPVLVHCENALICDELGEEAKREGRVTAHDYVASRPVFTEVEAIRRVLYL
3e74A           VRDVNDWQFFKGAQKLGELGQPVLVHCENALICDELGEEAKREGRVTAHDYVASRPVFTEVEAIRRVLYL
1e9zB           WGTTPSAINHALDVADKYDVQVAIHTDTLNEAGCVEDTMAAIAGRTMHTFHTEGAGGGHAPDIIKVAGEH
1a5mC           PAAIDCADEMDIQVALHSDTLNESGFVEDTLAAIGGRTIHTFHTEGAGGGHAPDIITACAHPNILPSSTN
3e74C           FVRDVNDWQFFKGAQKGELGQPVLVHCENALICDELGEEAKREGRVTAHDYVASRPVFTEVEAIRRVLYL
3d6nA           TDDGSPVMDSSVMRKALELASQLGVPIMDHCEDDKLAYGVINEGEVSALLGLSSRAPEAEEIQIARDGIL
2amxB           DVELIHKAFIKGIKNATELLNNKIHVALICISDKHSGDFAIK-HKHDFVGFDHGGREIDLKDHKDGLHLT
1cr5C           LGDIEPTSAVATG---------------------------------------------------------
1cr5A           LGDIEPTSAVATGTKGILTKQTQINFFKG-----------------------------------------
1cr5B           LGDIE-----------------------------------------------------------------
3c86A           FFLRE-IQHGIEDTGIRAGIIVATTGKATPFQELVLKAAARATGVPVTTHTSASQRDFESEGLSPSRVCI
2d2gA           FFLREIQHGIEDTGIRAGIIKVATTGKATPFQELVLKAAASLATGVPVTTHTSASQRDGEQQAAISRVCI
1a4mA           HQPSWSLEVLELCKKYNQKTVVAMDLA--------------GDETIEGSSLFPGHVEAYEGAVKNGIHRT
3e3hA           FFIEDTGIRAGIIVATTGKAFQELVLKAAARASLATGVPVTTHTAASQRDGEQQAAIFESEGLSPSRVCI
1a5lC           ----------------------------------------------------------------------
2a3lA           ---------------------------------------------------------------MTTITLR
2amxA           DVELIHKAFIKGIKNATELLNNKIHVALICISDTGHAADFAIKHKHDFVGFDHGGREIDLKDHKDVYHSV
3e2vB           KVISNPSFAQGKLKELYDLMNQQAKPHDTSFRSIGEIGLDYDRFHYSSKEMQKVFFEEQLKISCLNDKLS
2eg6B           NHGVTSVDAIMPVRMEKIGMPLLVHGEVTHADIDIFDREARFIESVMEPLRQRLT-ALKVVFEHITTKDA
3e2vA           KVISNPSFAQGKLKELYDLMNQQAKPHDTSFRSIGEIGLDYDRFHYSSKEMQKVFFEEQLKIS---CLND
1bf6A           QEMVDEIEQGIDGTELKAGIIAEIGTSEEEKVFIAAALAHNQTGRPISTHTSFSTMGLEQHGVDLSRVTV
1dpmA           QFFLREIQYGIEDTGGKATPFQELVLKAAARASLATGVPVTTHTAASQRDGEQQAAIFESEGLSPSRVCI


                         .         .         .         +         .         .         .:280
query           THLFNAMTPFTHREPGVVGAVFDSEITTETISDGIHIAYPSLRVAYKQKGTDKVLLITDAMMACCMPDGM
3egjA           THLFNAMTPMVGREPGVVGAIYDTPEVYAGIIADGFHVDYANIRIAHKIKGEKLVLVTDATAPAGAEMDY
3dugC           HGLIGIKAAIKAGVDSVEHASFIDDETIDMAIKNNTVLSMDIFVSDYILGEGAKAGIREESLNKERLVGK
3dugA           HGLIGIKAAIKAGVDSVEHASFIDDETIDMAIKNNTVLSMDIFVSDYILGEGAKAGIREESLNKERLVGK
3be7B           HGLIGIKAAIKAGVDSVEHASFIDDETIDMAIKNNTVLSMDIFVSDYILGEGAKAGIREESLNKERLVGK
3be7C           DEAHNHGMKVAAHAHGLIGIKAAIKAGVDSVEHASFIDDETIMAIKNNTVLSMDIFVSDYILGEGAKAGI
3dc8B           VHTSCEQAHEAIRRARAKGMRVFGEPLQHLTLDETEYFDKDHAARRVMSPPFRNKLHQDSLWAGLASGSL
2aqvB           FHMGDSKKALQPIYDLLENCDVPISKLLPTHVNRNVPLFEQALEFARKG--GTIDITSSIDEPVAPAEGI
2aqoA           FHMGDSKKALQPIYDLLECDVPISKLLPTHVNRNVPLFEQALEFARKGGTIDITSSIDEPVAPAEGIARA
1e9yB           NILPASTNPTIPFTVNTEAEHMDMLM----VCHHKDKSIKEDVQFADSRIRPQTIAAEDTLHDMGAFSIT
3egjB           THLFNAMTPMVGREPGVVGAIYTPEVYAGIIADGFHVDYANIRIAHKIKGEKLVLVTD-ATAPAGAEMDY
3be7A           HNHGMKVAAHAHGLIGIKAAIKAVEHASFIDDETIDVLSMDIFVSDYILGEGAKAGIREESLNKERLVGK
1a5kC           PTLPYTLNTIDEHLDMLMVCHHLDPIAEDVAFAESRIRRETIAAEDVHDLGAFSLTSSDSQAMGRVGEVI
3dc8A           ADMAGCPVYIVHRRARAKGMRVFGEPLIQLTLDETEYFDKDWDHAARRVMSPPFRNHQDSLWAGLASGSL
1ejsC           PTLPYTLNTIDEHLDMLMVCHHL------DPDIAEDVAFAESRIRRET------IAAEDVLHDLGAFSLT
1ejxC           EGAGGGHAPDIITACAHPNILPSSTYTLNTIDEHLDMLMVCVAFAESRIRRETIAAE-DVLHDLGAFSLT
1ejtC           PTLPYTLNTIDEHLDMLMVCHHLDPDIA------EDVAFAESRIRRET------IAAEDVLHDLGAFSLT
1ejwC           PTLPYTLNTIDEHLDMLMVCHHLDP------DIAEDVAFAESRIRRETIA------AEDVLHDLGAFSLT
2bb0A           AAEAGFGLKIHADEIDPLGAELAGKLKAVSADHLVGTSDEGIKKLAEAGTIAVLLPGTTFYLGKSTYARA
1ejrC           EGAGGGHAPDIITACAHPNILPSSTNTLPYTLNTIDEHLDMLMAFAESRIRRETIAAEDVLHDLGAFSLT
2aqvA           FHMGDSKKALQPIYDLLENCDVPISKLLPTHVNRNVPLFEQAL--EFARKGGTIDITSSIDEPVAPAEGI
1a5oC           PTLPYTLNTIDEHLDMLMVCHHLDPIAEDVAFAESRIRRETIAAE-------------DVLHDLGAFSLT
1ejuC           EGAGGGHAPDIITACAHPNILPSSTNTLPYTLNTIDEHLDMLMAFAESRIRRETIAAEDVLHDLGAFSLT
2aqoB           FHMGDSKKALQPIYDLLENCDVPISKLLPTHVNRNVPLFEQ--ALEFARKGGTIDITSSIDEPVAPAEGI
1a5nC           EGAGGGHAPDIITACAHPNILPSSTNPTLPYTLNTIDEHLDMAFAESRIRRETIAAE-DVLHDLGAFSLT
3e0lA           TSVYDKNNLLTNKTVMAHGCYLSAEELNVFHERGASIAHPNSNLSLSSGFLNVLEVLKHEVKIGLGTDVA
3e74B           AKVAGCRLHVCHVSSPEGVEEVTRARQEGQDITCESCPHYFVLDQFEEIGTLAKCSPENQKGWEKLFNGE
3e74A           AKVAGCRLHVCHVSSPEGVEEVTRAITCESCPHYFVLDTDQFEEGTLAKCSPPIRDLENQKGWEKLFNGE
1e9zB           NILPASTNPTIPFTVNTEAEMDMLMVCHHLDKSIKEDVQFADSRIRPQTIAAEDTLHDMGAFSITSSDSQ
1a5mC           PTLPYTLNTIDEHLDMLMVCHHLPDIAEDVAFAESRIRRIAAEDVLHDLGA-FSLTSSDSQAMGRVGEVI
3e74C           AKVAGCRLHVCHVSSPEGVEQEGQDITCESCPHYFVDQFEEIGTLAKCSPPIRDLENQKGWEK--LFNGE
3d6nA           AQRTGGHVHIQHVSTKLSLEIKGVKITCEVNPNHLLFTVLNSGANARVNPPLRKKEDRLALIEGVKRGII
2amxB           VHAGEDATLPNLNTLYTAINILNVE--RIGHGIRVSESDELIELVKKKDILLEVCPISNLLLNNVKSMDT
1cr5C           ----------------------------------------------------------------------
1cr5A           ----------------------------------------------------------------------
1cr5B           ----------------------------------------------------------------------
3c86A           GHSDDTDDLSYLTGLAARGVGLDRMPYSAIGLEGNASALALFGTRSWQTRALLIKALIDRGYKDRILVSH
2d2gA           GHSDDTDDLSYLTGLAARGYVGLDRMPYSAIGLEGNASALLIKALIDRGYKDRILVSHDWLFGFSSYVTN
1a4mA           VHAGEVGSPEVVRE-----AVDILKTERVGHGYHTIEDEALYNRLLKENMHFEVCPWSSYLTGAWDPKTT
3e3hA           GHSDDTDDLSYLTALAARGYLIGLDIPFSAIGLEDNASALLIKALIDQGYMKQILVSNDWLFGFSSYVTN
1a5lC           ----------------------------------------------------------------------
2a3lA           PHSGEAGDIDHLAATFLTCH-------SIAHGINLRKSPVLQYLYYLAQIGLAMSPLSNNSLFLDYHRNP
2amxA           RDHGLHLTVHAGEDATLPNYTAINILNVERIGHGRVSESDELIELVKKKDILLEVCPISNLLLNNVKSMD
3e2vB           SYPLFLHMRSACDDFVQILEVVGFTDEKDTFQLQKLSSSSGFYKFHPDRKLVVHSFTGSAIDLQKLLNLS
2eg6B           ADYVRDGNERLAATITPQHLMFNRNHMLVGGVRPHLYCLPILKRNIHQQALRELVASGFNRVFLGTDSAP
3e2vA           KLSSYPLFLHMRSACDDFVQILERFDEKDTFQLQKLSSSSGFYKFHPDRKLVVHSFTGSAIDLQKLLNSP
1bf6A           GHCDLKDNLDNILKMIDLGAYVQFDTIGKNSYYPDEKRIAMLHALRDRGLLNRVMLSMDITRRSHLKAN-
1dpmA           GHSDDTDDLSYLTALAARGYLLDHIPHSAIGLEDNASASALIKALIDQGYMKQILVSNDWLFGFSSYVTN


                         .         *         .         .         .         .         +:350
query           YSLGGQDVEVKNGAARLLSGSLAGSILTLDVAVKNIFKNTNYPLNEVIKMATYNGAKHCKVDDKKGLIKE
3egjA           FIFVGKKVYYRDGKCVDENGTLGGSALTMIEAVQNTVEHVGIALDEALRMATLYPAKAIGVDEKLGRIKK
3dugC           KQRENFMNAHRRGAIITFGTDAGIFDHGDNAKQFAYMVEWGMTPLEAIQASTIKTATLFGIEN-IGQIKE
3dugA           KQRENFMNAHRRGAIITFGTDAGIFDHGDNAKQFAYMVEWGMTPLEAIQASTIKTATLFGIEN-IGQIKE
3be7B           KQRENFMNAHRRGAIITFGTDAGIFDHGDNAKQFAYMVEWGMTPLEAIQASTIKTATLFGIEN-IGQIKE
3be7C           REESLNKERLRRGAIITFGTDAGIFDHGDNAKQFAYMVEWGMTPLEAIQASTIKTATLFGIEN-IGQIKE
3dc8B           QVVATDHCAFGVGDFTRIPNGTGGLEDRMPMLWTYGVATGRITMNEFVAVTSTNIAKILNIYPKKGAILV
2aqvB           ARAVQAGIPLARVTLSSDGNGSVAGFETLLETVQVLVKDYDFSISDALRPLTSSVAGFLNLTGK-GEILP
2aqoA           VQAGIPLARVTLSSDGNGSQIGVAGFETLLETVQVLVKDYDFSISDALRPLTSSVAGFLNL-TGKGEILP
1e9yB           SSDSQAMGRVGEVITRTWQTA-DKNKKEFGRLKEEKGDNDNFRIKRYLSKYTINPAIAHGISEYVGSVEV
3egjB           FIFVGKKVYYRDGKCVDENGTLGGSALTMIEAVQNTVEHVGIALDEALRMATLYPAKAIGVDEKLGRIKK
3be7A           KQRENFMNAHRRGAIITFGTDAGIFDHGDNAKQFAYMVEWGMTPLEAIQASTIKTATLFGIEN-IGQIKE
1a5kC           LRTWQ---------------VAHRMKVQRGALAEETGDNDNFRVKRYIAKYTINPALTHGIAHEVGSIEV
3dc8A           QVVATEQKRFGVGDFTRIPNGTGGLEDRMPMLWTYGVATGRITMNEFVAVTSTNIAKILNIYPKKGAILV
1ejsC           SSDSQAMGRVGEVILRTWQV-AHRMKVQRGALAEETGDNDNFRVKRYIAKYTINPALTHGIAHEVGSIEV
1ejxC           SSDSQAMGRVGEVILRTWQVA-HRMKVQRGALAEETGDNDNFRVKRYIAKYTINPALTHGIAHEVGSIEV
1ejtC           SSDSQAMGRVGEVILRTWQV-AHRMKVQRGALAEETGDNDNFRVKRYIAKYTINPALTHGIAHEVGSIEV
1ejwC           SSDSQAMGRVGEVILRTWQV-AHRMKVQRGALAEETGDNDNFRVKRYIAKYTINPALTHGIAHEVGSIEV
2bb0A           RAMIDEGVCVSLATDF---NPGSSPTENIQLIMSIAALHLKMTAEEIWHAVTVNAAYAIGKGEEAGQLKA
1ejrC           SSDSQAMGRVGEVILRTWQV-AHRMKVQRGALAEETGDNDNFRVKRYIAKYTINPALTHGIAHEVGSIEV
2aqvA           ARAVQAGIPLARVTLSSDGNGGVAGFETLLETVQVLVKDYDFSISDALRPLTSSVAGFLNLTGK-GEILP
1a5oC           SSDSQAMGRVGEVILRTWQV-AHRMKVQRGALAEETGDNDNFRVKRYIAKYTINPALTHGIAHEVGSIEV
1ejuC           SSDSQAMGRVGEVILRTWQV-AHRMKVQRGALAEETGDNDNFRVKRYIAKYTINPALTHGIAHEVGSIEV
2aqoB           ARAVQAGIPLARVTLSSDGNGSVAGFETLLETVQVLVKDYDFSISDALRPLTSSVAGFLNLTGK-GEILP
1a5nC           SSDSQAMGRVGEVILRTWQVA-HRMKVQRGALAEETGDNDNFRVKRYIAKYTINPALTHGIAHEVGSIEV
3e0lA           GGYSYSM-----------LDAIRRAVMVSNILLINKVNEKSLTLKEVFRLATLGGSQALGLDGEIGNFEV
3e74B           IDCLVSDHSP--CPPEKAGNIKAWGGIAGLQSCDVFDEAVQKRGSLPFGKLATNAADIFGLQQK-GRIAP
3e74A           IDCLVSDHSPCPPEKAGNIKAWGGIAGLQSCD--VFDEAVQKRGSLPFGKLATNAADIFGLQQ-KGRIAP
1e9zB           AMGRVGEV------ITRTWQTADKNKKEFGRLKEEKGDNDNFRIKRYLSKYTINPAIAHGISEYVGSVEV
1a5mC           LRTWQ---------------VAHRMKVQRGALAEETGDNDNFRVKRYIAKYTINPALTHGIAHEVGSIEV
3e74C           IDCLVSDHSPCPPEKAGNIKAWGGIAGLQ--SCDVFDEAVQKRGSLPFGKLATNAADIFGLQQ-KGRIAP
3d6nA           DCFATDHAPHQTFEKELVEFAMPGILQTALPSALELYRKGIISLKKLIEMFTINPARIIGVD--LGTLKL
2amxB           HPIR--KLYDAGVKVSVNSDDPGMFLSNINDNYEKLYIHLNFTL-EEFMIMNNWAFEKSFVSDDVKSELK
1cr5C           ----------------------------------------------------------------------
1cr5A           ----------------------------------------------------------------------
1cr5B           ----------------------------------------------------------------------
3c86A           DWLFGFSSYVTNIMDV-MDRINPDGMAFVPLRVIPFLREKGVPPETLAGVTVANPAR-------------
2d2gA           IMDVMDR-------------INPDGMAFVPLRVIPFLREKGVPPETLAGVTVANPAR-------------
1a4mA           HAV--VRFKNDKANYSLNTDDPLIFKSTLDTDYQMTKKDMGFTE-EEFKRLNINAAKSSFLEEKKELLER
3e3hA           IMDVMDRVNPDG-------------MAFIPLRVIPFLREKGVPQETLAGITVTNPARFLSPTLR------
1a5lC           ----------------------------------------------------------------------
2a3lA           FPVFFLRG-LNVSLSTDDPLQIHLTKEPLVEEYSIAASVWKLSAC-DLCEIARNSVYQSGFSHALKSHWI
2amxA           THPIRKLYDAGVKVS-VNSDDPGMFLSNINDNYEKLYIHLNFTLEEF-MIMNNWAFEKSFVSDDVKSELK
3e2vB           PNIFIGVNGCSLRTEENLA--VVKQIPTERLLLETDAPWCEKRTHASFQYLAKYQEVRDFEYPAFKSVKK
2eg6B           HARH--RKESSCGCAGCFNAPTALGSY-ATVFEEMN------ALQHFEAFCSVNGPQFYGLPVNDTFIEL
3e2vA           NIFIGVNGCSLR--TEENLAVVKQIPTERLLLETDAPWCEIKRTHASFQYLAKYQEVRDFEYPAFKSVKK
1bf6A           ---GGYGYD------------------YLLTTFIPQLRQSGFSQADVDVMLRENPSQFFQ----------
1dpmA           IMDVMD----RVNPD---------GMAFIPLRVIPFLREKGVPQETLAGITVTNPAR-------------


                         .         .         .         .         *         .         .:420
query           GYDADLILFDDNIDIKYVIVNGKLVHKA
3egjA           GMIANLTVFDRDFNVKATVVNGQY----
3dugC           GFDADIVGVIENEEVAFVMKEGKVYKR-
3dugA           GFDADIVGVIENEEVAFVMKEGKVYKR-
3be7B           GFDADIVGVIENEEVAFVMKEGKVYKR-
3be7C           GFDADIVGVIENEEVAFVMKEGKVYKR-
3dc8B           GADADLVVWDPKRLPRFTLTRGVVSIE-
2aqvB           GNDADLLVMTPELRIEQVYARGKLMVK-
2aqoA           GNDADLLVMTPELRIEQVYARGKLMVK-
1e9yB           GKVADLVLWSPAGDANASIPTPQPVYY-
3egjB           GMIANLTVFDRDFNVKATVVNGQ-YEQ-
3be7A           GFDADIVGVIENEEVAFVMKEGKVYKR-
1a5kC           GKLADLVVWSPAGVKPATVIKGGMI---
3dc8A           GADADLVVWDPKRLPRFTLTRGVVSIE-
1ejsC           GKLADLVVWSPAFFMIAIAPMGDINA--
1ejxC           GKLADLVVWSPAFFMIAIAPMGDINA--
1ejtC           GKLADLVVWSPAGGMIAIAPMGDINA--
1ejwC           GKLADLVVWSPAFFMIAIAPMGDINA--
2bb0A           GRSADLVIWQAPNHVHQVMKNGTIVVN-
1ejrC           GKLADLVVWSPAFFPTPQPVHYRPMFGA
2aqvA           GNDADLLVMTPELRIEQVYARGKLMVK-
1a5oC           GKLADLVVWSPAFFMIAIAPMGDINA--
1ejuC           GKLADLVVWSPAGGMIAIAPMGDINA--
2aqoB           GNDADLLVMTPELRIEQVYARGKLMVK-
1a5nC           GKLADLVVWSPAFFMIAIAPMGDINA--
3e0lA           GKEFDAILINPKRNIEEVYVGGKQVV--
3e74B           GKDADFVFIQPNARITKTILRGDVIYD-
3e74A           GKDADFVFIQPNARITKTILRGDVIYD-
1e9zB           GKVADLVLWSPAFDANASIPTPQPVY--
1a5mC           GKLADLVVWSPAGGMIAIAPMGDINA--
3e74C           GKDADFVFIQPNARITKTILRGDVIYD-
3d6nA           GSPADITIFDPNGKVIYTIKDGKMVYK-
2amxB           A---------------------------
1cr5C           ----------------------------
1cr5A           ----------------------------
1cr5B           ----------------------------
3c86A           ----------------------------
2d2gA           ----------------------------
1a4mA           LY--------------------------
3e3hA           ----------------------------
1a5lC           ----------------------------
2a3lA           GKDYYKRGPDGNEEMQQVYLGKAVISD-
2amxA           A---------------------------
3e2vB           NKLADKLNAEELYMVKGRNEPCNMEQVA
2eg6B           VREEQQVAESI-----------------
3e2vA           NKLADKLNAEELYMVKGRNEPCNMEQVA
1bf6A           ----------------------------
1dpmA           ----------------------------