[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for cper0:BAB81914.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2c5mC.bssp"
#ERROR : Can't open dsspfile "2c5mB.bssp"
#ERROR : Can't open dsspfile "1cs0B.bssp"
#ERROR : Can't open dsspfile "1a9xB.bssp"
#ERROR : Can't open dsspfile "1c30B.bssp"
#ERROR : Can't open dsspfile "1bxrB.bssp"
#ERROR : Can't open dsspfile "2c5mA.bssp"
#ERROR : Can't open dsspfile "1aodA.bssp"
#ERROR : Can't open dsspfile "2c5mD.bssp"
#ERROR : Can't open dsspfile "3dadB.bssp"
#ERROR : Can't open dsspfile "2an1A.bssp"
#ERROR : Can't open dsspfile "2abwA.bssp"
#ERROR : Can't open dsspfile "2an1B.bssp"
#ERROR : Can't open dsspfile "2abwB.bssp"
#ERROR : Can't open dsspfile "2a9vD.bssp"
#ERROR : Can't open dsspfile "2a9vB.bssp"
#ERROR : Can't open dsspfile "3d54D.bssp"
#ERROR : Can't open dsspfile "3efeB.bssp"
#ERROR : Can't open dsspfile "3bweE.bssp"
#ERROR : Can't open dsspfile "3efeD.bssp"
#ERROR : Can't open dsspfile "2a9vC.bssp"
#ERROR : Can't open dsspfile "3dadA.bssp"
#ERROR : Can't open dsspfile "2a9vA.bssp"
#ERROR : Can't open dsspfile "3bweD.bssp"
#ERROR : Can't open dsspfile "1aa7B.bssp"
#ERROR : Can't open dsspfile "2d7jA.bssp"
#ERROR : Can't open dsspfile "1aa7A.bssp"
#ERROR : Can't open dsspfile "3efeF.bssp"
#ERROR : Can't open dsspfile "2an1C.bssp"
#ERROR : Can't open dsspfile "3czaA.bssp"
#ERROR : Can't open dsspfile "3cy6A.bssp"
#ERROR : Can't open dsspfile "2bejA.bssp"
#ERROR : Can't open dsspfile "3efeC.bssp"
#ERROR : Can't open dsspfile "2an1D.bssp"
#ERROR : Can't open dsspfile "2c5uA.bssp"
#ERROR : Can't open dsspfile "3efeA.bssp"
#ERROR : Can't open dsspfile "3csqA.bssp"
#ERROR : Can't open dsspfile "3b36A.bssp"
#ERROR : Can't open dsspfile "3cz9A.bssp"
#ERROR : Can't open dsspfile "2bekB.bssp"
#ERROR : Can't open dsspfile "2ab0A.bssp"
#ERROR : Can't open dsspfile "1cf9A.bssp"
#ERROR : Can't open dsspfile "3b3aA.bssp"
#ERROR : Can't open dsspfile "2bekA.bssp"
#ERROR : Can't open dsspfile "3b38A.bssp"
#ERROR : Can't open dsspfile "2dgyA.bssp"
#ERROR : Can't open dsspfile "1di7A.bssp"
#ERROR : Can't open dsspfile "1dkwB.bssp"
#ERROR : Can't open dsspfile "3bhnA.bssp"

## Summary of PDB Search
:535
    e-113  49%  2c5mC  [x.x.x] CTP SYNTHASE
    1e-75  47%  2c5mB  [x.x.x] CTP SYNTHASE
    2e-59  15%  1cs0B  [c.8.3 - c.23.16] CARBAMOYL PHOSPHATE SYNTHETASE: SMALL
    2e-58  14%  1a9xB  [c.8.3 - c.23.16] CARBAMOYL PHOSPHATE SYNTHETASE (SMALL
    4e-55  16%  1c30B  [c.8.3 - c.23.16] CARBAMOYL PHOSPHATE SYNTHETASE: SMALL
    3e-52  16%  1bxrB  [c.8.3 - c.23.16] CARBAMOYL-PHOSPHATE SYNTHASE
    2e-46  45%  2c5mA  [x.x.x] CTP SYNTHASE
    3e-44   8%  1aodA  [x.x.x] PHOSPHATIDYLINOSITOL-SPECIFIC PHOSPHOLIPASE C
    3e-42  47%  2c5mD  [x.x.x] CTP SYNTHASE
    3e-38  12%  3dadB  [x.x.x] FH1/FH2 DOMAIN-CONTAINING PROTEIN 1
    6e-31  16%  2an1A  [x.x.x] PUTATIVE KINASE
    7e-31  12%  2abwA  [x.x.x] PDX2 PROTEIN
    9e-31  14%  2an1B  [x.x.x] PUTATIVE KINASE
    8e-29  13%  2abwB  [x.x.x] PDX2 PROTEIN
    1e-28  20%  2a9vD  [x.x.x] GMP SYNTHASE
    2e-28  22%  2a9vB  [x.x.x] GMP SYNTHASE
    2e-26  16%  3d54D  [x.x.x] PHOSPHORIBOSYLFORMYLGLYCINAMIDINE SYNTHASE 1
    2e-26  15%  3efeB  [x.x.x] THIJ/PFPI FAMILY PROTEIN
    3e-26  12%  3bweE  [x.x.x] PROTEIN DJ-1
    7e-26  16%  3efeD  [x.x.x] THIJ/PFPI FAMILY PROTEIN
    3e-25  19%  2a9vC  [x.x.x] GMP SYNTHASE
    3e-25  17%  3dadA  [x.x.x] FH1/FH2 DOMAIN-CONTAINING PROTEIN 1
    5e-25  22%  2a9vA  [x.x.x] GMP SYNTHASE
    2e-24  12%  3bweD  [x.x.x] PROTEIN DJ-1
    2e-24  11%  1aa7B  [a.95.1] INFLUENZA VIRUS MATRIX PROTEIN
    3e-24  18%  2d7jA  [x.x.x] GMP SYNTHASE [GLUTAMINE-HYDROLYZING] SUBUNIT A
    9e-24   9%  1aa7A  [a.95.1] INFLUENZA VIRUS MATRIX PROTEIN
    1e-23  15%  3efeF  [x.x.x] THIJ/PFPI FAMILY PROTEIN
    1e-23  15%  2an1C  [x.x.x] PUTATIVE KINASE
    6e-23  11%  3czaA  [x.x.x] PROTEIN DJ-1
    1e-22  10%  3cy6A  [x.x.x] PROTEIN DJ-1
    2e-22  13%  2bejA  [x.x.x] SEGREGATION PROTEIN
    3e-22  14%  3efeC  [x.x.x] THIJ/PFPI FAMILY PROTEIN
    5e-22  14%  2an1D  [x.x.x] PUTATIVE KINASE
    2e-21   9%  2c5uA  [x.x.x] RNA LIGASE
    8e-21  14%  3efeA  [x.x.x] THIJ/PFPI FAMILY PROTEIN
    4e-20  10%  3csqA  [x.x.x] MORPHOGENESIS PROTEIN 1
    1e-19  10%  3b36A  [x.x.x] PROTEIN DJ-1
    2e-18  11%  3cz9A  [x.x.x] PROTEIN DJ-1
    8e-17  13%  2bekB  [x.x.x] SEGREGATION PROTEIN
    1e-16  16%  2ab0A  [x.x.x] YAJL
    4e-16  12%  1cf9A  [e.5.1 - c.23.16] PROTEIN (CATALASE HPII)
    2e-13  12%  3b3aA  [x.x.x] PROTEIN DJ-1
    2e-13  13%  2bekA  [x.x.x] SEGREGATION PROTEIN
    2e-09  15%  3b38A  [x.x.x] PROTEIN DJ-1
    5e-08   3%  2dgyA  [x.x.x] MGC11102 PROTEIN
    4e-07  12%  1di7A  [c.57.1] MOLYBDENUM COFACTOR BIOSYTHETIC ENZYME
    5e-05  19%  1dkwB  [c.1.1] TRIOSEPHOSPHATE ISOMERASE
    2e-04  20%  3bhnA  [x.x.x] THIJ/PFPI DOMAIN PROTEIN
:535

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxKNTKYVFVTGGVVSSLGKGITAASLGRLLKNRGLSVSIQKFDPYLNIDPGTMSPYQHGEVFVTDDGAE
2c5mC           -----KYILVTGGVISGIGKGIIASSVGTILKSCGLHVTSIKIDPYINIDAGTFSPYEHGEVFVLDDGGE
2c5mB           -----KYILVTGGVISGIGKGIIASSVGTILKSCGLHVTSIKIDPYINIDAGTTKD--------------
1cs0B           ----------------------------------------------------------------------
1a9xB           ----------------------------------------------------------------------
1c30B           ----------------------------------------------------------------------
1bxrB           ----------------------------------------------------------------------
2c5mA           --QSMKYILVTGGVISGIGKGIIASSVGTILKSCGLHVTSIKIDPYINIDATKDNNL-------------
1aodA           ----------------------------------------------------------------------
2c5mD           -----KYILVTGGVISGIGKGIIASSVGTILKSCGLHVTSIKIDPYINID--------------------
3dadB           -----------------------------------------QRPTLILRTQLSVRVNAILEKLYSSSGPE
2an1A           ----------------------------------------------------------------------
2abwA           ----------------------------------------------------------------------
2an1B           ----------------------------------------------------------------------
2abwB           ----------------------------------------------------------------------
2a9vD           ----------------------------------------------------------------------
2a9vB           ----------------------------------------------------------------------
3d54D           ----------------------------------------------------------------------
3efeB           ----------------------------------------------------------------------
3bweE           ----------------------------------------------------------------------
3efeD           ----------------------------------------------------------------------
2a9vC           ----------------------------------------------------------------------
3dadA           ----------------------------------------------------------------------
2a9vA           ----------------------------------------------------------------------
3bweD           ----------------------------------------------------------------------
1aa7B           ----------------------------------------------------------------------
2d7jA           ----------------------------------------------------------------------
1aa7A           ----------------------------------------------------------------------
3efeF           ----------------------------------------------------------------------
2an1C           ----------------------------------------------------------------------
3czaA           ----------------------------------------------------------------------
3cy6A           ----------------------------------------------------------------------
2bejA           ----VRRIALANQK-GGVGKTTTAINLAAYLARLGKRVLLVDLDPQGNATSGLGVRAERGVYHLLQGEPL
3efeC           ----------------------------------------------------------------------
2an1D           ----------------------------------------------------------------------
2c5uA           -------------------------------------------------------------DDVSASGRT
3efeA           ----------------------------------------------------------------------
3csqA           ----PNQPERGDQAEYWYKNLSLQLAQFPMDIINISQGENGSFSHKGTLCIDFVGKTEKYPYYAPCDCTC
3b36A           ----------------------------------------------------------------------
3cz9A           ----------------------------------------------------------------------
2bekB           ----VRRIALANQK-GGVGKTTTAINLAAYLARLGKRVLLVDLAPQGNATSGLGVRAERGVYHLLQGEPL
2ab0A           ----------------------------------------------------------------------
1cf9A           ----------------------------------------------------------------------
3b3aA           ----------------------------------------------------------------------
2bekA           ----VRRIALANQK-GGVGKTTTAINLAAYLARLGKRVLLVDLAPQGNATSGLGVRAERGVYHLLQGEPL
3b38A           ----------------------------------------------------------------------
2dgyA           ----------------------------------------------------------------------
1di7A           ----------------------------------------------------------------------
1dkwB           ----------------------------------------------------------------------
3bhnA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           TDLDLGHYERFIDENLTQNSNVTSGRVYWSVISKERKGEYLGGTVQVIPHITNAIKDRVHRVGKERDXXX
2c5mC           DI------------RLTKDNNLTTGKIYQYVINKERKGDYLGKTVQVVPHITDAIQEWVMRQALEPQVCV
2c5mB           -------------------NNLTTGKIYQYVINKERKGDYLGKTVQVVPHITDAIQEWVMRQALIDEPQV
1cs0B           ----------------------------------------------------------------------
1a9xB           ----------------------------------------------------------------------
1c30B           ----------------------------------------------------------------------
1bxrB           ----------------------------------------------------------------------
2c5mA           ----------------------TTGKIYQYVINKERKGDYLGKTVQVVPHITDAIQEWVMRQALIPEPQV
1aodA           ---TTKQWMSALPDTLAALSIPGTHDTMSYNGDITWTLTKPLAQTQTMSL-YQQLEAGIRYIDIR-AKDN
2c5mD           -------------AGLTKDNNLTTGKIYQYVINKERKGDYLGKTVQVVPHITDAIQEWVMRQALEPQVCV
3dadB           LRRSLFSLKQIFQEDKDLVPEFVHSEGLSCLIRVGAAADH-----NYQSYILRALGQLML-------FVD
2an1A           ----------------------------------------------------------------------
2abwA           ----------------------------------------------------------------------
2an1B           ----------------------------------------------------------------------
2abwB           ----------------------------------------------------------------------
2a9vD           ----------------------------------------------------------------------
2a9vB           ----------------------------------------------------------------------
3d54D           ----------------------------------------------------------------------
3efeB           ----------------------------------------------------------------------
3bweE           ----------------------------------------------------------------------
3efeD           ----------------------------------------------------------------------
2a9vC           ----------------------------------------------------------------------
3dadA           ----------------------------------------------------------------------
2a9vA           ----------------------------------------------------------------------
3bweD           ----------------------------------------------------------------------
1aa7B           ----------------------------------------------------------------------
2d7jA           ----------------------------------------------------------------------
1aa7A           ----------------------------------------------------------------------
3efeF           ----------------------------------------------------------------------
2an1C           ----------------------------------------------------------------------
3czaA           ----------------------------------------------------------------------
3cy6A           ----------------------------------------------------------------------
2bejA           EGLVHPVDGFHLLP--ATPDLVGATVELAGAPTALREALRDEGYDLVLLDAPPSLSPLTLNALAAAE---
3efeC           ----------------------------------------------------------------------
2an1D           ----------------------------------------------------------------------
2c5uA           YRIFSYNYASYSDWLLPDAGIFEDGEKPVRIASRPEKFFNLNENPFTNIDLNDKEDGSLVSTYLDGDEIL
3efeA           ----------------------------------------------------------------------
3csqA           VWRGDASAYLAWTSDKEVMCADGSVRYITWVGKKLKKGDLMGHTGIGGDHWHFNVIDGKEYQGWTKKPDS
3b36A           ----------------------------------------------------------------------
3cz9A           ----------------------------------------------------------------------
2bekB           EGLV--HPVDGFHLLPATPDLVGATVELAGAPTALREALRDEGYDLVLLDAPPSLSPLTLNALAAAE--G
2ab0A           ----------------------------------------------------------------------
1cf9A           ----------------------------------------------------------------------
3b3aA           ----------------------------------------------------------------------
2bekA           EGLVHPVDGFHLLP--ATPDLVGATVELAGAPTALREALRDEGYDLVLLDAPPSLSPLTLNALAAAE--G
3b38A           ----------------------------------------------------------------------
2dgyA           ----------------------SNQQQIVRVLRTPGNNLHTAQGQRFLVSMPSKYRKNIWIKRGDFLIVD
1di7A           ----------------------------------------------------------------------
1dkwB           ----------------------------------------------------------------------
3bhnA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           XXXXXXXXXXXXXSLPFLEAIRQIKYDVGKENVCFIHVTLVPYLGKAGELKTKPTQHSVKELRSIGIQPD
2c5mC           IELGGTVGDIE--SMPFIEAFRQFQFKVKRENFCNIHVSLVPQPSSTGEQKTKPTQNSVRELRGLGLSPD
2c5mB           CVIELGGTVGDIESMPFIEAFRQFQFKVKRENFCNIHVSLVPQPSSTGEQKTKPTQNSVRELRGLGLSPD
1cs0B           -------------------------------EVVF-NTSMTGYQ----EILTDPVGTNDADEESSQVHAQ
1a9xB           --------------------------------------------------LTYPHIGNVADEESSQVHAQ
1c30B           -----------------------------------------------------------ADEESSQVHAQ
1bxrB           -----------------------------------------------------------ADEESSQVHAQ
2c5mA           CVIELGGTVGDIESMPFIEAFRQFQFKVKRENFCNIHVSLVPQPSSTGEQKTKPTQNSVRELRGLGLSPD
1aodA           LNIYHGPIFLNASLSGVLETITQFLK----KNPKETIIMRLKDEQNSNDSFDYRIQPLINIYKDYFYTTP
2c5mD           IELGGTVGDIE--SMPFIEAFRQFQFKVKRENFCNIHVSLVPQPSSTGEQKTKPTQNSVRELRGLGLSPD
3dadB           GMLGVVAHSDTIQWLYTLCASLSRLVVKTALKLLLVFV----EYSENNAPLFIRAVNSVASTT--GAPPW
2an1A           ----------------------------------------------------------------------
2abwA           ----------------------------------------------------------------------
2an1B           ----------------------------------------------------------------------
2abwB           ----------------------------------------------------------------------
2a9vD           ----------------------------------------------------------------------
2a9vB           ----------------------------------------------------------------------
3d54D           ----------------------------------------------------------------------
3efeB           ----------------------------------------------------------------------
3bweE           ----------------------------------------------------------------------
3efeD           ----------------------------------------------------------------------
2a9vC           ----------------------------------------------------------------------
3dadA           -----------------------------------------------NAPLFIRAVNSVASTTGAPPWAN
2a9vA           ----------------------------------------------------------------------
3bweD           ----------------------------------------------------------------------
1aa7B           ----------------------------------------------------------------------
2d7jA           ----------------------------------------------------------------------
1aa7A           ----------------------------------------------------------------------
3efeF           ----------------------------------------------------------------------
2an1C           ----------------------------------------------------------------------
3czaA           ----------------------------------------------------------------------
3cy6A           ----------------------------------------------------------------------
2bejA           ----GVVVPVQAEYYALEGVAGLLATLEEVRAGLNPRLRLLGILVTMYDGRTLLAQQVEAQLRAFGEKVF
3efeC           ----------------------------------------------------------------------
2an1D           ----------------------------------------------------------------------
2c5uA           FKSKGSIKSEQALANGILNINHHRLRDRL-------KELAEDGFTANFEFVAPTNR-IVLAYQEKIILLN
3efeA           ----------------------------------------------------------------------
3csqA           CLAGTELHIYDVFAVNNVEIINGNGYDWKTSDW-------------------------------------
3b36A           ----------------------------------------------------------------------
3cz9A           ----------------------------------------------------------------------
2bekB           VVVPVQAEYYALEGVAGLLATLEEVRAGLNPRLRLLGILVTMY-----DGRTLLAQQVEAQLRAFGEKVF
2ab0A           ----------------------------------------------------------------------
1cf9A           --------------------------------------------------------------LSQTPFEQ
3b3aA           ----------------------------------------------------------------------
2bekA           VVVPVQAEYYALEGVAGLLATLEEVRAGLNPRLRLLGILVTMY-----DGRTLLAQQVEAQLRAFGEKVF
3b38A           ----------------------------------------------------------------------
2dgyA           PIEEGEKVKAEISFVLCKDHVRSLQ---------------------------------------------
1di7A           ----------------------------------------------------------------------
1dkwB           ---------------------------------------------------------SLPSLKDFGVNWI
3bhnA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           IIVCRSEKELSEDIKKKIGLFCNIDASEVIQNLDAEHLYAVPLMLHKEGLDRLVCEKLGLGCRDIDNAEW
2c5mC           LVVCRCSNPLDTSVKEKISMFCHVEPEQVICVHDVSSIYRVPLLLEEQGVVDYFLRRLDL----------
2c5mB           LVVCRCSNPLDTSVKEKISMFCHVEPEQVICVHDVSSIYRVPLLLEEQGVVDYFLRRLDL----------
1cs0B           GLVIRDLPLIASNFRNTEDLSSYLKRHNIVAIADIDTRKLTRLLREKGAQNGCIIAGDNPDAALALEKAR
1a9xB           GLVIRDLPLIASNFRNTEDLSSYLKRHNIVAIADIDTRKLTRLLREKGAQNGCIIAGDNPDAALALEKAR
1c30B           GLVIRDLPLIASNFRNTEDLSSYLKRHNIVAIADIDTRKLTRLLREKGAQNGCIIAGDNPDAALALEKAR
1bxrB           GLVIRDLPLIASNFRNTEDLSSYLKRHNIVAIADIDTRKLTRLLREKGAQNGCIIAGDNPDAALALEKAR
2c5mA           LVVCRCSNPLDTSVKEKISMFCHVEPEQVICVHDVSSIYRVPLLLEEQGVVDYFLRRLDL----------
1aodA           RTDTSNKIPTLKDVRGKILLLSENHTKKPLVINSRKFGMQFGAPNQVIQDDYNGPSVKTKFKEIVQTAYQ
2c5mD           LVVCRCSNPLDTSVKEKISMFCHVEPEQVICVHDVSSIYRVPLLLEEQGVVDYFLRRLDL----------
3dadB           ANLVSILEEKNGADPELLVYTVTLINKTLAALPDQDSFYDVTDALEQQGMEALVQRHLGTAGTDVDLRTQ
2an1A           ----------------------------------------------------------------------
2abwA           ----------------------------------------------------------------------
2an1B           ----------------------------------------------------------------------
2abwB           ----------------------------------------------------------------------
2a9vD           ----------------------------------------------------------------------
2a9vB           ----------------------------------------------------------------------
3d54D           ----------------------------------------------------------------------
3efeB           ----------------------------------------------------------------------
3bweE           ----------------------------------------------------------------------
3efeD           ----------------------------------------------------------------------
2a9vC           ----------------------------------------------------------------------
3dadA           L-VSILEEKNGADPELLVYTVTLINKT-LAALPDQDSFYDVTDALEQQGMEALVQRHLGTAGTDVDLRTQ
2a9vA           ----------------------------------------------------------------------
3bweD           ----------------------------------------------------------------------
1aa7B           ------------------------------------------------------------TEVETYVLSI
2d7jA           ----------------------------------------------------------------------
1aa7A           --------------------------------------------------------------VETYVLSI
3efeF           ----------------------------------------------------------------------
2an1C           ----------------------------------------------------------------------
3czaA           ----------------------------------------------------------------------
3cy6A           ----------------------------------------------------------------------
2bejA           WTVIPRNVRLAEAPSFGKTIAQHAPTSPGAHAYRR-----------------------------------
3efeC           ----------------------------------------------------------------------
2an1D           ----------------------------------------------------------------------
2c5uA           VRENETGEYISYDDIYKDATLRPYLVERYEIDSPKWIEEAKNAENIEGYVAVKDGSHFK--IKSDWYVSL
3efeA           ----------------------------------------------------------------------
3csqA           ----------------------------------------------------------------------
3b36A           ----------------------------------------------------------------------
3cz9A           ----------------------------------------------------------------------
2bekB           WTVIPRNVRLAEAPSFGKTIAQHAPTSPGAHAYRR-----------------------------------
2ab0A           ----------------------------------------------------------------------
1cf9A           RHIVDSKVVRPYIRERVVDQLAHIDLT--LAQAVAKNLIELTDDQLNITPPPDVNGLKKDPSLSLYAIPD
3b3aA           ----------------------------------------------------------------------
2bekA           WTVIPRNVRLAEAPSFGKTIAQHAPTSPGAHAYRR-----------------------------------
3b38A           ----------------------------------------------------------------------
2dgyA           ----------------------------------------------------------------------
1di7A           ----------------------------------------------------------------------
1dkwB           VLG-HSERETNEIVADKVAAAVASGFMVIACIGETLQERESGRTAVV------VLTQIAAIAKKLKKADW
3bhnA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           IDMVHRITHLTHTTKIALVGKYVELHDAYISVVEALNHGGLSNDTNVEIEWINAEDVTKENVDELLSGVD
2c5mC           ----------------------------------------------------------------------
2c5mB           ----------------------------------------------------------------------
1cs0B           AFPGLNGMDLAKEVTTAEAYSWTQGSWTLTGGLPEAKKEDELPFHVVAYDFGAKRNIQTSAEDVLKMNPD
1a9xB           AFPGLNGMDLAKEVTTAEAYSWTQGSWTLTGGLPQAKKEDELPFHVVAYDFGAKRNIQTSAEDVLKMNPD
1c30B           AFPGLNGMDLAKEVTTAEAYSWTQGSWTLTGGLPEAKKEDELPFHVVAYDFGAKRNAQTSAEDVLKMNPD
1bxrB           AFPGLNGMDLAKEVTTAEAYSWTQGSWTLTGGLPQAKKEDELPFHVVAYDFGAKRNIQTSAEDVLKMNPD
2c5mA           ----------------------------------------------------------------------
1aodA           ASKADNKLFLNHISATSLTTPRQYAAALNNKVEQFVLNLTSEKVRGLGILIMDFPEKTIKNI--------
2c5mD           ----------------------------------------------------------------------
3dadB           LVLYENALKLED----------------------------------------------------------
2an1A           -----------HFKCIGIVGHTT-----HEMLYRWLCDQGYEVIEQQIAHELQLKNVPTGTLAEIGQQAD
2abwA           --------------TIGVLSLQ----GDFEPHINHFIKLQ---IPSLNIIQVRN--------VHDLGLCD
2an1B           -----------HFKCIGIVGHTT-----HEMLYRWLCDQGYEVIVEQQIAHELQLNVPTGTLAEIGQQAD
2abwB           --------------TIGVLSLQ----GDFEPHINHFIKLQ---IPSLNIIQVRNVH--------DLGLCD
2a9vD           -----------HHLKIYVV-------DNGGQWTHREWRVLRELGVDTKIVPNDIDSSE-------LDGLD
2a9vB           --------------KIYVV-------DNGGQWTHREWRVLRELGVDTKIVPNDIDSSE-------LDGLD
3d54D           ------------KPRACVVVYPG--SNCDRDAYHALEING------FEPSYVGL--------DDKLDDYE
3efeB           -----------QTKKAFYVFNTMSDWE-YGYLIAELNSGRDLAPLKVITVGANKEMITTMGGLRILESKD
3bweE           ------------------TVIPVDVRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLEDA---KKEGPYD
3efeD           ------------TKKAFYVFNTMSDWE-YGYLIAELNSGRDLAPLKVITVGANKEMITTMGGLRILESKD
2a9vC           --------------KIYVV-------DNGGQWTHREWRVLRELGVDTKIVPNDIDSSE-------LDGLD
3dadA           LVLYENALKLED----------------------------------------------------------
2a9vA           -----------HHLKIYVV-------DNGGQWTHREWRVLRELGVDTKIVP---NDIDSSELD----GLD
3bweD           ------------------TVIPVDVRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLEDA---KKEGPYD
1aa7B           IPSGPLKAEIAQRLEDVFAGKNTDL-----EVLMEWLKTRPILSPLTKGILGFVFTLTVPSERGLQR--R
2d7jA           ----------------------IVIMDNGGQYVHRIWRTLRYLGVETKIIPNTTPLEEIKAMNP-----K
1aa7A           IPSGPLKAEIAQRLEDVFAGKNTDL-----EVLMEWLKTRPILSPLTKGILGFVFTLTVPSERGLQR--R
3efeF           ------------TKKAFYVFNTMSDWE-YGYLIAELNSGRYFKPLKVITVGANKEMITTMGGLRILESKD
2an1C           --------------CIGIVGHT-----THEMLYRWLCDQGY----EVIVEQQIAHE---LQVPTGTLAEI
3czaA           -----------GAEEMDTVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLEDA---KKEGPYD
3cy6A           ------------SKRALILAKGAEEMQ-TVIPVDVMRRAGIKVTVAGLARDVVICPDASLEDAKKEGPYD
2bejA           ----------------------------------------------------------------------
3efeC           --------------KAFYVFNTMSDWE-YGYLIAELNSGRDLAPLKVITVGANKEMITTMGGLRILESKD
2an1D           -------------------FKCIGIVGTHEMLYRWLCDQGY----EVIVEKVPTGTL-----AEIGQQAD
2c5uA           HSTKSSLDNPEKLFKTIIDGASDDLKAYADDEYSYRKIEAFETTYLKYLDRALFLVLDCHN---------
3efeA           ------------TKKAFYVFNTMSDWE-YGYLIAELNSGRDLAPLKVITVGANKEMITTMGGLRILESKD
3csqA           ----------------------------------------------------------------------
3b36A           --------------RALILAKGAEEME-TVIPVDVLRRAGIKVTVAGLAGKDPVQCSRDVVIAKKEGPYD
3cz9A           --------------RALILAKGAEEML-TVIPVDVMRRAGIKVTVAGLAGKDPVQCVVICPDASLEDPYD
2bekB           ----------------------------------------------------------------------
2ab0A           ------------SASALCLAPGSEETEAVT-TIDLLVRGGASVASDGNLAITCSRGVKLLADEVADGEYD
1cf9A           GDVKGRVVAILLNDEVALKAKGVHAKLLYSRMGEVTADDGTVLPIAATFAGAPSLTV------------D
3b3aA           --------------RALILAKGAEEME-TVIPVDVMRRAGIKVTVAGLAGKDPVQCVVICPDASLEDPYD
2bekA           ----------------------------------------------------------------------
3b38A           --------------RALILAKGAEEME-TVIPVDVMRRAGAGLAGKDPVQCSRDVVICPDASAKKEGPYD
2dgyA           ----------------------------------------------------------------------
1di7A           -----------------ISDRYQDKGIPA--LEEWLTSALTTPFELETRLIPDEQAIIEQTLCELEMSCH
1dkwB           AKVVYEPVWAIGTGKVATPQQAQEAHALIRSWVSS----KIGADVAGELRILYGGSVNGKNARTLYRDVN
3bhnA           -------------------------------------------------------DGHVSEVKEQ----D


                         .         .         .         .         *         .         .:420
query           GVLVPGGFGDRGVEGKIEAIRWARENKKPFLGICLGMQCAVIEYARNVLGLEGAHSSELNPETPFPVIDL
2c5mC           ----------------------------------------------------------------------
2c5mB           ----------------------------------------------------------------------
1cs0B           GIFLSNGPGDAPCDYAITAIQKFLETDIPV-FGILGHQLLALASGAKTVKMKFGHHGGNHPVKDV-----
1a9xB           GIFLSNGPGDPAPCDYAITAIQKFLETDIPVFGILGHQLLALASGAKTVKMKFGHHGGNHP---------
1c30B           GIFLSNGPGDPAPCDYITAIQKFLETDIPVFGISLGHQLLALASGAKTVKMKFGHHGGNHPVK-------
1bxrB           GIFLSNGPGDAPCDYAITAIQKFLETDIPVFGICLGHQLLALASGAKTVKMKFGHHG-------------
2c5mA           ----------------------------------------------------------------------
1aodA           ----------------------------------------------------------------------
2c5mD           ----------------------------------------------------------------------
3dadB           ----------------------------------------------------------------------
2an1A           LAVVVGGDG-----NMLGAARTLARYDINVIGINRGGFLTDLDPDNALQQLSDVLEGRYISEKRFLLEAQ
2abwA           GLVIPGGESTTVRRCCAALVHFIHVLKKPIWGTCAGCILLSKNVENIKLYSNFGNKFSFGGLDITICRNF
2an1B           LAVVVGGDGN-----MLGAARTLARYDINVIGINRGNLGFLTDLDPDNAL---------------QQLSD
2abwB           GLVIPGGESTTVRRCCAALVHFIHVLKKPIWGTCAGCILLSKNVENIKLYSNFGNKFSFGGLDI------
2a9vD           GLVLSGGNIDEELDKLGSVGKYIDDHNYPILGICVGAQFIALHFGASV----------------------
2a9vB           GLVLSGGNIDEELDKLGSVGKYIDDHNYPILGICVGAQFIALHFGASVVKAKHPEFGK------------
3d54D           LIILPGGFSYGDYLRPGAVIAKAAERGKLIMGINGFQILIEMGLLKGALLQNSSGKFI-CKWVDLIVENN
3efeB           LLILPGGTTWEIHQPILERIGQALKIGTIVAAICGATDALANMGYLDTRKHTSNNLEYTKMVCPNYKGEK
3bweE           VVVLPGGNLGSESAAVKEILKEQENRKGLIAAICAGPTALLAHEIGFGSKVTTHPLAKDKNGGHYTYSEN
3efeD           LLILPGGTTWSIHQPILERIGQALKIGTIVAAICGATDALANMGYLDTRKHTSNNLEYTKMVCPNYKGEK
2a9vC           GLVLSGGNIDEELDKLGSVGKYIDDHNYPILGICVGAQFIALHFGASVVKAKHPEF--------------
3dadA           ----------------------------------------------------------------------
2a9vA           GLVLSGGNIDEELDKLGSVGKYIDDHNYPILGICVGAQFIALHFGASVVK--------------------
3bweD           VVVLPGGNLGSESAAVKEILKEQENRKGLIAAICAGPTALLAHEIGFGSKVTTHPLAKDKNGGHYTYSEN
1aa7B           RFVQNALNGNGDPNNMDKAVKLYRITFHGAKEISLSYSAGALASCMGLIYNMGAVTTEVAFGLVCATCE-
2d7jA           GIIFSGGPSLENTGNCEKVLEHYDEFNVPILGICLGHQLIAKFFGGKVGRGE-------KAEYSLVEIEI
1aa7A           RFVQNALNGNMDKAVKLYRKLKREITFHGAKEISLSYSAGALASCMGLIYNRMGAVT-------------
3efeF           LLILPGGTTWEIHQPILERIGQALKIGTIVAAICGATDAMGYLDTRKHTSNNLEYTKMVCPNYKGEKFYE
2an1C           GQQADLAVVVGGDGNMLGAARTLARYDINVIGINRGNLGF---------------LTDLDPDNALQQLSD
3czaA           VVVLPGGNLGSESAAVKEILKEQENRKGLIAAICAGPTALLAHEIGFGSKVTTHPLAKDKMMNGGHYTYS
3cy6A           VVVLPGGNLGSESAAVKEILKEQENRKGLIAAICAGPTALLAHEIGFGSKVTTHPLAKDKMMNGGHYTYS
2bejA           ----------------------------------------------------------------------
3efeC           LLILPGGTTWEIHQPILERIGQALKIGTIVAAICGATDALANMGYLDTRKHTSNNLEYTKMVCPNYKGEK
2an1D           LAVVVGGDGN-----MLGAARTLARYDINVIGINRGNLGFLTDLD---------------PDNALQQLSD
2c5uA           -----KHCGKDRKTYAEAQGVAKGAGDHLFGIISLYQGYDSQEKVCEIEQNFLKNYKKFIPE--------
3efeA           LLILPGGTTWSIHQPILERIGQALKIGTIVAAICGATDALANMGYLDTRKHTSNNLEYTKMVCPNYKGEK
3csqA           ----------------------------------------------------------------------
3b36A           VVVLPGGNLGSESAAVKEILKEQENRKGLIAAICAGPTALLAHEIGFGSKVTTHPLAKDKMMNGGHYTYS
3cz9A           VVVLPGGNLGSESAAVKEILKEQENRKGLIAAICAGPTALLAHEIGFGSKVTTHPLAKDKMMNGGHYTYS
2bekB           ----------------------------------------------------------------------
2ab0A           VIVLPGGIKGRDSTLLVETVKQFHRSGRIVAAICAAPATVLVPHDIFPIGNMTGF-----PTLKDKIPAE
1cf9A           AVIVPCGNIAADNGDANYYLMEAYKHLKPIALAGDARKFKATIKIADQGEEGIVEADSADGSFMDELLTL
3b3aA           VVVLPGGNLGSESAAVKEILKEQENRKGLIAAICAGPTALLAHEIGFGSKVTTHPLAKDKMMNGGHYTYS
2bekA           ----------------------------------------------------------------------
3b38A           VVVLPGGNLGSESAAVKEILKEQENRKGLIAVICAGPTA-------------------------------
2dgyA           ----------------------------------------------------------------------
1di7A           LVLTTGGTGPARRDVTPDATLAVADREMPGFGEQMRQISPTAILSRQVGVIRKQALILNLPGQPKSIKET
1dkwB           GFLVGLK---------------------------------------------------------------
3bhnA           VVLITSGYRPAALQDENFSALKLDPSRQLIGSICAGSFV-------------------------------


                         .         .         +         .         .         .         .:490
query           MPEQKDVEDLGGTMRLGLYPCKLEDNTFCKDVYASDLIYERHRHRYEFNNEYRTQLIESGLTIAGTSPDG
2c5mC           ----------------------------------------------------------------------
2c5mB           ----------------------------------------------------------------------
1cs0B           --------------------------------EKNVVMITAQNHGFAVDEAT----LPANLRVTHKSLFD
1a9xB           ----------------------------VKDVEKNVVMITAQNHGFAVDEATLPA----NLRVTHKSLFD
1c30B           ------------------------------DVEKNVVMITAQNHGFAVDEAT----LPANLRVTHKSLFD
1bxrB           ------------------------GNHPVKDVEKNVVMITAQNHGFAVDEATLPA----NLRVTHKSLFD
2c5mA           ----------------------------------------------------------------------
1aodA           ----------------------------------------------------------------------
2c5mD           ----------------------------------------------------------------------
3dadB           ----------------------------------------------------------------------
2an1A           VCQQRISTAINEVV------------------LHPGKVAHMIEFEVYIDETFAFSQRSDGLIIS--TPTG
2abwA           NDSF----------------------ICSLNIISDSSAFKKDLTAACIRAPYIREILSDEVKVLATFSHE
2an1B           VLEGR--YISEKRFLLEAQVCQQDRQKRISTAINEVVLHPGKVAHVYIDETFAFSQRSDGLIISPTGSTA
2abwB           ------------TICRNFYGSQNDSFICSLNIISDSSAFKKDLTAACIRAPYIREILSDEVKVLATFSHE
2a9vD           --------VKAKHPEFGKTKVSVHSENIFGGLPSEITVWENHNDEIINLPD--------DFTLAASSATC
2a9vB           ----TKVSVHSENIFGGLPSE----------------ITVWENHNDEIIN------LPDDFTLAASSATC
3d54D           DTPFTNAFEKGEKIRIPIAHG---------FGRYVKIDDVNVVLRYVKDVNGSDERI-------------
3efeB           FYELGPAVS-DANLVTASGIAPLE---FAMEVLKKVFTLDALHSWYNLNKTHKPEYFFQLMNSIN-----
3bweE           RVE---KDGLILTSRGPGTSFEFALAIVEALNGKEVAAQVKAPLVLK-----------------------
3efeD           FYELGPAVS-DANLVTASGIAPLEFA-MEVLKKIDVFTLDALHSWYNLNK--------------------
2a9vC           ----------------GKTKVSVHSENIFGGLPSEITVWENHNDEIINL---------PDDFTLAASSAT
3dadA           ----------------------------------------------------------------------
2a9vA           ----------AKHPEFGKTKVSVHSENIFGGLP--SEITVWENHNDEIIN------LPDDFTLAASSATC
3bweD           RVE---KDGLILTSRGPGTSFEFALAIVEALNGKEVAAQVKAPLVLK-----------------------
1aa7B           ----------------------------------------------------------------------
2d7jA           IDEDEIFKGLP------------------------KRLKVWESHMDEVKELP------PKFKILARSETC
1aa7A           ----------------------------------------------------------------------
3efeF           LGPAVS----DANLVTASGIAPLEFAMEVLKKIDVF-TLDALHSWYNLNKTHKPEYFFQLMN--------
2an1C           VLEGR--YISEKRFLLEAQVCQQDRQKRISTAIN-EVVLHPGKHMIEFEVYIDETFAF-SQRSDGLIIST
3czaA           ENRVEKDGLIGTSFEFALAIVEALNGK---------EVAAQVKAPLVL----------------------
3cy6A           ENRV-EKDGLILTSRGPGTSFEFALAIVEAL--NGKEVAAQVKAPLVL----------------------
2bejA           ----------------------------------------------------------------------
3efeC           FYELGPAVS-DANLVTASGIAPLEFAMEVLKKIDVF-TLDALHSWYNLNKTHKPEYFFQLMN--------
2an1D           VLEGRY--ISEKRFLLEAQVCQQDRQKRISTAINEVVLHPGKVAHMIEFEVYIDETFAFSQRSDGLIIST
2c5uA           ----------------------------------------------------------------------
3efeA           FYELGPAVS-DANLVTASGIAPLEFAMEVLKKIDVFTL-DALHSWYNLNKTHKPEYFFQLMNSIN-----
3csqA           ----------------------------------------------------------------------
3b36A           ENRVEKDGLIGTSFEFALAIVEALNGKE---------VAAQVKAPLVL----------------------
3cz9A           ENRV----EKDGLILTSRGPGTSEFALAIVEALNGKEVAAQVKAPLVL----------------------
2bekB           ----------------------------------------------------------------------
2ab0A           QWLDKRVVWDGTAIDFGLKIIDLLVGREKAHEVASQLVMAAGIYNYY-----------------------
1cf9A           MAAHRVWSRIPKIDKI------------------------------------------------------
3b3aA           ENEVEKDGLIGTSFKFALAIVEALNGKEVAAQVKAPLVL-------------------------------
2bekA           ----------------------------------------------------------------------
3b38A           ----------------------------------------------------------------------
2dgyA           ----------------------------------------------------------------------
1di7A           LEGVK-DAEGNVVVHGIFASVPYCIQLLEGPVETAPEVVAAFRPKSA-----------------------
1dkwB           ----------------------------------------------------------------------
3bhnA           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           RLVECVEVKDHPWFVAVQYHPELKSRPNRPHPLFVGFVGAALNNK
2c5mC           ---------------------------------------------
2c5mB           ---------------------------------------------
1cs0B           GTLQGIHRTDKPAF-SFQGHPEASPGPHDAAPLFDHFIELIEQYR
1a9xB           GTLQGIHRTDKPAF-SFQGNPEASPGPHDAAPLFDHFIELIEQYR
1c30B           GTLQGIHRTDKPAF-SFQGHPEASPGPHDAAPLFDHFIELIEQYR
1bxrB           GTLQGIHRTDKPAF-SFQGHPEASPGPHDAAPLFDHFIELIEQYR
2c5mA           ---------------------------------------------
1aodA           ---------------------------------------------
2c5mD           ---------------------------------------------
3dadB           ---------------------------------------------
2an1A           STA------YSLSAGGPILTPSLDLVPMFPHTLSARPLVINSSST
2abwA           YGPNIIAAVEQNNCLGTVFHPELLPHTA----FQQYFYEKVKNYK
2an1B           YSLSAGGPILTPSLDAITLVPMFPHTLSARPLVINSSSTIRL---
2abwB           SGPNIIAAVEQNNCLGTVFHPELLPHTA----FQQYFYEKVKNYK
2a9vD           Q-VQGFYHKTRPIY-ATQFHPEVEHTQYG-RDIFRNFIGICASYR
2a9vB           Q-VQGFYHKTRPIY-ATQFHPEVEHTQYG-RDIFRNFIGICASYR
3d54D           ---AGVLNESGNVF-GLMPHPERAVEELIGGEDGKKVFQSILN--
3efeB           ---------------------------------------------
3bweE           ---------------------------------------------
3efeD           -------------THKPEYFFQLMNSINK----------------
2a9vC           CQVQGFYHKTRPIY-ATQFHPEVEHTQYG-RDIFRNFIGICASYR
3dadA           ---------------------------------------------
2a9vA           Q-VQGFYHKTRPIY-ATQFHPEVEHTQYG-RDIFRNFIGICASYR
3bweD           ---------------------------------------------
1aa7B           ---------------------------------------------
2d7jA           P-IEAMKHEELPIY-GVQFHPEVAHTEKG-EEILRNFAKLC----
1aa7A           ---------------------------------------------
3efeF           ---------------------------------------------
2an1C           PTGSTA---YSLSAGGPILTPSLDLVPMFPHTLSARPLVINSSST
3czaA           ---------------------------------------------
3cy6A           ---------------------------------------------
2bejA           ---------------------------------------------
3efeC           ---------------------------------------------
2an1D           P--TGSTAYSLS-AGGPILTPSLDAIPMFPHTLSARPLVINSSST
2c5uA           ---------------------------------------------
3efeA           ---------------------------------------------
3csqA           ---------------------------------------------
3b36A           ---------------------------------------------
3cz9A           ---------------------------------------------
2bekB           ---------------------------------------------
2ab0A           ---------------------------------------------
1cf9A           ---------------------------------------------
3b3aA           ---------------------------------------------
2bekA           ---------------------------------------------
3b38A           ---------------------------------------------
2dgyA           ---------------------------------------------
1di7A           ---------------------------------------------
1dkwB           ---------------------------------------------
3bhnA           ---------------------------------------------