[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for cper0:BAB82028.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2cimB.bssp"
#ERROR : Can't open dsspfile "2cjaB.bssp"
#ERROR : Can't open dsspfile "1b76A.bssp"
#ERROR : Can't open dsspfile "1atiB.bssp"
#ERROR : Can't open dsspfile "2cjaA.bssp"
#ERROR : Can't open dsspfile "2cimA.bssp"
#ERROR : Can't open dsspfile "1atiA.bssp"
#ERROR : Can't open dsspfile "2dq0A.bssp"
#ERROR : Can't open dsspfile "2cjbA.bssp"
#ERROR : Can't open dsspfile "2cj9A.bssp"
#ERROR : Can't open dsspfile "2du3A.bssp"
#ERROR : Can't open dsspfile "2du5A.bssp"
#ERROR : Can't open dsspfile "1adjA.bssp"
#ERROR : Can't open dsspfile "3bjuD.bssp"
#ERROR : Can't open dsspfile "1asyA.bssp"
#ERROR : Can't open dsspfile "2dq2A.bssp"
#ERROR : Can't open dsspfile "2cjbB.bssp"
#ERROR : Can't open dsspfile "2d32C.bssp"
#ERROR : Can't open dsspfile "1e1tA.bssp"
#ERROR : Can't open dsspfile "2cj9B.bssp"
#ERROR : Can't open dsspfile "3bjuC.bssp"
#ERROR : Can't open dsspfile "2dq3A.bssp"
#ERROR : Can't open dsspfile "3e9hA.bssp"
#ERROR : Can't open dsspfile "1eiyA.bssp"
#ERROR : Can't open dsspfile "3cmqA.bssp"
#ERROR : Can't open dsspfile "1c0aA.bssp"
#ERROR : Can't open dsspfile "1bbuA.bssp"
#ERROR : Can't open dsspfile "1bbwA.bssp"
#ERROR : Can't open dsspfile "2du3B.bssp"
#ERROR : Can't open dsspfile "3cw4A.bssp"
#ERROR : Can't open dsspfile "2du5B.bssp"
#ERROR : Can't open dsspfile "2bamB.bssp"
#ERROR : Can't open dsspfile "2eiuC.bssp"
#ERROR : Can't open dsspfile "1bhmB.bssp"
#ERROR : Can't open dsspfile "3dsqA.bssp"
#ERROR : Can't open dsspfile "3bamA.bssp"
#ERROR : Can't open dsspfile "1e1oA.bssp"
#ERROR : Can't open dsspfile "1b70A.bssp"
#ERROR : Can't open dsspfile "2du4A.bssp"
#ERROR : Can't open dsspfile "2eiuD.bssp"
#ERROR : Can't open dsspfile "2bamA.bssp"
#ERROR : Can't open dsspfile "3dsqB.bssp"
#ERROR : Can't open dsspfile "2du7A.bssp"
#ERROR : Can't open dsspfile "2eiuE.bssp"
#ERROR : Can't open dsspfile "2e3cA.bssp"
#ERROR : Can't open dsspfile "11asA.bssp"
#ERROR : Can't open dsspfile "2d6fD.bssp"
#ERROR : Can't open dsspfile "1bhmA.bssp"
#ERROR : Can't open dsspfile "3d1tB.bssp"
#ERROR : Can't open dsspfile "1b8aA.bssp"
#ERROR : Can't open dsspfile "2e1bA.bssp"
#ERROR : Can't open dsspfile "3bjuB.bssp"
#ERROR : Can't open dsspfile "2e7gA.bssp"
#ERROR : Can't open dsspfile "3c2wC.bssp"
#ERROR : Can't open dsspfile "2c7fB.bssp"
#ERROR : Can't open dsspfile "2ddzE.bssp"

## Summary of PDB Search
:643
    5e-58  12%  2cimB  [x.x.x] SERYL-TRNA SYNTHETASE
    1e-57  14%  2cjaB  [x.x.x] SERYL-TRNA SYNTHETASE
    1e-57  17%  1b76A  [d.104.1 - c.51.1] PROTEIN (GLYCYL-TRNA SYNTHETASE)
    7e-57  17%  1atiB  [d.104.1 - c.51.1] GLYCYL-TRNA SYNTHETASE
    3e-54  14%  2cjaA  [x.x.x] SERYL-TRNA SYNTHETASE
    1e-53  13%  2cimA  [x.x.x] SERYL-TRNA SYNTHETASE
    7e-52  18%  1atiA  [d.104.1 - c.51.1] GLYCYL-TRNA SYNTHETASE
    2e-51  19%  2dq0A  [x.x.x] SERYL-TRNA SYNTHETASE
    3e-49  13%  2cjbA  [x.x.x] SERYL-TRNA SYNTHETASE
    7e-46  14%  2cj9A  [x.x.x] SERYL-TRNA SYNTHETASE
    1e-45   9%  2du3A  [x.x.x] O-PHOSPHOSERYL-TRNA SYNTHETASE
    3e-45   9%  2du5A  [x.x.x] O-PHOSPHOSERYL-TRNA SYNTHETASE
    6e-44  14%  1adjA  [d.104.1 - c.51.1] HISTIDYL-TRNA SYNTHETASE
    5e-43  10%  3bjuD  [x.x.x] LYSYL-TRNA SYNTHETASE
    1e-42  10%  1asyA  [b.40.4 - d.104.1] ASPARTYL-TRNA SYNTHETASE
    7e-41  18%  2dq2A  [x.x.x] SERYL-TRNA SYNTHETASE
    3e-40  14%  2cjbB  [x.x.x] SERYL-TRNA SYNTHETASE
    1e-39  12%  2d32C  [x.x.x] GLUTAMATE--CYSTEINE LIGASE
    2e-39  12%  1e1tA  [b.40.4 - d.104.1] LYSYL-TRNA SYNTHETASE
    4e-39  12%  2cj9B  [x.x.x] SERYL-TRNA SYNTHETASE
    5e-38  10%  3bjuC  [x.x.x] LYSYL-TRNA SYNTHETASE
    1e-37  20%  2dq3A  [x.x.x] SERYL-TRNA SYNTHETASE
    1e-33   9%  3e9hA  [x.x.x] LYSYL-TRNA SYNTHETASE
    8e-33  15%  1eiyA  [a.2.7 - d.104.1] PHENYLALANYL-TRNA SYNTHETASE
    7e-32   8%  3cmqA  [x.x.x] PHENYLALANYL-TRNA SYNTHETASE, MITOCHONDRIAL
    7e-32  10%  1c0aA  [b.40.4 - d.104.1 - d.74.4] ASPARTYL TRNA SYNTHETASE
    1e-30  11%  1bbuA  [b.40.4 - d.104.1] PROTEIN (LYSYL-TRNA SYNTHETASE)
    2e-28  10%  1bbwA  [b.40.4 - d.104.1] PROTEIN (LYSYL-TRNA SYNTHETASE)
    1e-26  10%  2du3B  [x.x.x] O-PHOSPHOSERYL-TRNA SYNTHETASE
    1e-26   8%  3cw4A  [x.x.x] POLYMERASE BASIC PROTEIN 2
    2e-26  10%  2du5B  [x.x.x] O-PHOSPHOSERYL-TRNA SYNTHETASE
    2e-25  10%  2bamB  [c.52.1] PROTEIN (ENDONUCLEASE BAMHI)
    8e-25   7%  2eiuC  [x.x.x] HYPOTHETICAL PROTEIN AQ_1627
    1e-24  10%  1bhmB  [c.52.1] PROTEIN (BAMHI (E.C.3.1.21.4))
    2e-24  16%  3dsqA  [x.x.x] PYRROLYSYL-TRNA SYNTHETASE
    6e-24  10%  3bamA  [c.52.1] PROTEIN (RESTRICTION ENDONUCLEASE BAMHI)
    7e-24  10%  1e1oA  [b.40.4 - d.104.1] LYSYL-TRNA SYNTHETASE
    1e-23  16%  1b70A  [d.104.1] PHENYLALANYL-TRNA SYNTHETASE
    1e-22  10%  2du4A  [x.x.x] O-PHOSPHOSERYL-TRNA SYNTHETASE
    2e-22   9%  2eiuD  [x.x.x] HYPOTHETICAL PROTEIN AQ_1627
    3e-22  10%  2bamA  [c.52.1] PROTEIN (ENDONUCLEASE BAMHI)
    3e-22  16%  3dsqB  [x.x.x] PYRROLYSYL-TRNA SYNTHETASE
    6e-22   6%  2du7A  [x.x.x] O-PHOSPHOSERYL-TRNA SYNTHETASE
    8e-21   9%  2eiuE  [x.x.x] HYPOTHETICAL PROTEIN AQ_1627
    1e-20  14%  2e3cA  [x.x.x] PYRROLYSYL-TRNA SYNTHETASE
    2e-20   9%  11asA  [d.104.1] ASPARAGINE SYNTHETASE
    9e-20   8%  2d6fD  [x.x.x] GLUTAMYL-TRNA(GLN) AMIDOTRANSFERASE SUBUNIT E
    4e-18   9%  1bhmA  [c.52.1] PROTEIN (BAMHI (E.C.3.1.21.4))
    2e-16  14%  3d1tB  [x.x.x] UPF0343 PROTEIN NGO0387
    1e-15  10%  1b8aA  [b.40.4 - d.104.1] PROTEIN (ASPARTYL-TRNA SYNTHETASE)
    1e-14  13%  2e1bA  [x.x.x] 216AA LONG HYPOTHETICAL ALANYL-TRNA SYNTHETASE
    3e-13  10%  3bjuB  [x.x.x] LYSYL-TRNA SYNTHETASE
    2e-12  10%  2e7gA  [x.x.x] PUTATIVE RIBOSOME-BINDING FACTOR A
    4e-08  13%  3c2wC  [x.x.x] BACTERIOPHYTOCHROME
    3e-04   6%  2c7fB  [x.x.x] ALPHA-L-ARABINOFURANOSIDASE
    8e-04  12%  2ddzE  [x.x.x] 190AA LONG HYPOTHETICAL PROTEIN
:643

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxITLKDGSIKEVEAGLSIFEIAQSISQGLARNACCGILNGKVEDLRFIVNEDSSLEICTFDSKEGQHA
2cimB           ----------------------------------------------------------------------
2cjaB           ---------------------------------------------------QFNLKAYFKTSADP-----
1b76A           ----------------------------------------------------------------------
1atiB           ----------------------------------------------------------------------
2cjaA           ----------------------------------------------------------------------
2cimA           -----------------------------------------------------NLKAYFKTSADPTPA--
1atiA           ----------------------------------------------------------------------
2dq0A           ----------------------------------------------------------------------
2cjbA           ----------------------------------------------------------------------
2cj9A           ----------------------------------------------------------------------
2du3A           ----------------------------------------------------------------------
2du5A           ----------------------------------------------------------------------
1adjA           ----------------------------------------------------------------------
3bjuD           ----------------------------------------------------------------------
1asyA           ----------------------------------------------------------------------
2dq2A           ----------------------------------------------------------------------
2cjbB           ----------------------------------------------------LQFNLKAYFKDPTPAKDA
2d32C           ----------------------------------------------------------------------
1e1tA           ----------------------------------------------------------------------
2cj9B           ----------------------------------------------------------------------
3bjuC           ----------------------------------------------------------------------
2dq3A           ----------------------------------------------------------------------
3e9hA           ----------------------------------------------------------------------
1eiyA           ----------------------------------------------------------------------
3cmqA           ----------------------------------------------------------------------
1c0aA           ----------------------------------------------------------------------
1bbuA           ----------------------------------------------------------------------
1bbwA           ----------------------------------------------------------------------
2du3B           ----------------------------------------------------------------------
3cw4A           ----------------------------------------------------------------------
2du5B           ----------------------------------------------------------------------
2bamB           ----------------------------------------------------------------------
2eiuC           ----------------------------------------------------------------------
1bhmB           ----------------------------------------------------------------------
3dsqA           ----------------------------------------------------------------------
3bamA           ----------------------------------------------------------------------
1e1oA           ----------------------------------------------------------------------
1b70A           ----------------------------------------------------------------------
2du4A           ----------------------------------------------------------------------
2eiuD           ----------------------------------------------------------------------
2bamA           ----------------------------------------------------------------------
3dsqB           ----------------------------------------------------------------------
2du7A           ----------------------------------------------------------------------
2eiuE           ----------------------------------------------------------------------
2e3cA           ----------------------------------------------------------------------
11asA           ----------------------------------------------------------------------
2d6fD           ----------------------------------------------------------------------
1bhmA           ----------------------------------------------------------------------
3d1tB           ----------------------------------------------------------------------
1b8aA           ----------------------------------------------------------------------
2e1bA           ---IFYPTGGGQPHDRGINGVEVLDVYKDE-------EGNVWHVVKEPEKFKVGDEVELKIDWDYRYKLM
3bjuB           ----------------------------------------------------------------------
2e7gA           ----------------------------------------------------------------------
3c2wC           ----------------------------------------------------------------------
2c7fB           ----------------------------------------------------------------------
2ddzE           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           FNHTASHVLAAAVKRLFPQDKLAIGPSIDNGFYYDFDTEKPFSADQLNXXXXXXXXXXXXXXXXXRFELP
2cimB           ---SHMKLQFLKAYFKTSADPTPAKDAIAALFEENSTLLTRGAPEGQGAKVTEWKDRIELTLQSGRYVRV
2cjaB           ------TPAKDAIAALFEEANSTLAPEGQGAKVTEWKLGEDRIELTLQSGRYVRVHDAIFRLRKQLAEA-
1b76A           ----------------------------------------------------------------------
1atiB           ----------------------------------------------------------------------
2cjaA           ------------------------KLQFNKAYFKKDAIAALFEPEGQGAKVTEWKLRIELTLQSGRYVRV
2cimA           -----KDAIAALFEEANSTLLTRGAPEGQGAKVTEWKLGEDRIELTLQSGRYVRVHDAIFRLRKQLAEAL
1atiA           ----------------------------------------------------------------------
2dq0A           ----------------------------------------------------------------------
2cjbA           --------------------HMKLQFNLKAYFKTKDAIAALFTRGAPEGQGATEWDRIELTLQSGRYVRV
2cj9A           ---------------------------MKLQFNLKA----YFAKDAIAALFEEANSTLLTRGAPEGQGAK
2du3A           ----------------------------------------------------------------------
2du5A           ----------------------------------------------------------------------
1adjA           ----------------------------------------------------------------------
3bjuD           -----------------------------------------------------------------YYKIR
1asyA           -----------------------------YGKLPLIQSRDSDRTGQKRVKFVDLDEAKDSDKEVLFRARV
2dq2A           ----------------------------------------------------------------------
2cjbB           IAALFEEANSTLLTRGAPEGQGAKVTEWKL-------GEDRIELTL------------QSGRYVRVHDAI
2d32C           ----------------------------------------------------------------------
1e1tA           ---------AIDFNDELRNRREKLAALRQQGVAFPNDFRRDHTSDQLH----------------EEFDAK
2cj9B           -----------------------------MKLQFNLKAY-FKTSADPTPAKDAIAALFEEANSTLLTRGA
3bjuC           -----------------------------------------------------------------PHKFH
2dq3A           ----------------------------------------------------------------------
3e9hA           -----------------------------------------------------------------GKRFE
1eiyA           ----------------------------------------------------------------------
3cmqA           ----------------------------------------------------------------------
1c0aA           ----------------------------------------------------------------------
1bbuA           -------------------------------------------------------------------DFR
1bbwA           -------------------------------------------------------------------DFR
2du3B           ----------------------------------------------------------------------
3cw4A           ----------------------------------------------------------------------
2du5B           ----------------------------------------------------------------------
2bamB           ----------------------------------------------------------------------
2eiuC           ----------------------------------------------------------------------
1bhmB           ----------------------------------------------------------------------
3dsqA           ----------------------------------------------------------------------
3bamA           ----------------------------------------------------------------------
1e1oA           -----------------------------------------------------------------PNDFR
1b70A           ----------------------------------------------------------------------
2du4A           ----------------------------------------------------------------------
2eiuD           ----------------------------------------------------------------------
2bamA           ----------------------------------------------------------------------
3dsqB           ----------------------------------------------------------------------
2du7A           ----------------------------------------------------------------------
2eiuE           ----------------------------------------------------------------------
2e3cA           ----------------------------------------------------------------------
11asA           ----------------------------------------------------------------------
2d6fD           ----------------------------------------------------------------------
1bhmA           ----------------------------------------------------------------------
3d1tB           ----------------------------------------------------------------------
1b8aA           ----------------------------------------------------------------------
2e1bA           RIHTGLHLLEHVLNEVLGEGQLVGSGMSVEKGRYDIAYPENLN---------------------KYKEQI
3bjuB           ----------------------------------------------------------------------
2e7gA           ----------------------------------------------------------------------
3c2wC           ----------------------------------------------------------------------
2c7fB           ----------------------------------------------------------------------
2ddzE           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           RNEALELMKDEPYKVELINDLPEGEVISFYQIGDFVDLCAGPHLMAVKPIKAVKLLRSTGAYWKGDEKNK
2cimB           HDAIFRLRKQLAEALGKKYI-EVESFIIKVPADHELRMLKVPYIKSMENIEGGIQLELEVGEAEMK--NR
2cjaB           --------LGKKYKIGIRGIEVESFIIKVPADHELRLK--VPYIKSENIEGGIQLELEVGEAEKNRVPDR
1b76A           ----------------------------------------------------------------------
1atiB           ----------------------------------------------------------------------
2cjaA           HDAIFRLRKQKKYKIGIRGIEVESFIIKVPADHELRL--KVPYIKSENIEGGIQLELEVGEAEKNRVPDR
2cimA           ---------GKKYKIGIRGIEVESF-IIKVPADHELRMLKVPYIKSMENIEGGIQL--ELEVGEAEMKNR
1atiA           ----------------------------------------------------------------------
2dq0A           ----------------------------------------------------------------KDENDN
2cjbA           HDAIFRLRKQLAEIEV-------ESFIIKVPADHELRMLKVPYIKSMENIEGGIQLELE--VGEAEMKNR
2cj9A           VTEWDRIDAIFRLRKQLAEGIEVESFIIKVPADHELRMLKVPYIKSMENIEGGIQLEL--EVGEAEMKNR
2du3A           ----------------------------------GKEILAERSPNELYPRVGFSFGKEHPLFATIQRLRE
2du5A           ----------------------------------GKEILAERSPNELYPRVGFSFGKEHPLFATIQRLRE
1adjA           ----------------------------------------------------------------------
3bjuD           SQAIHQLNGEDPYPHKFHVDISLTDFIQKYSHLQPGDHLTDITLKVAGRIHAKRASGGKLIFYDLRGEGV
1asyA           HNLAFLTLRQQASLIQGLVKANKEGTISKNMVKWAGSLNLESIVLVRGIVKKVDEPIKSATVQNLEIHIT
2dq2A           -------------------------------------------------LWRLPNITHPSVPVGKDENDN
2cjbB           FRLRKQLAEALGKK--YRGIEVESFIIKVPADHELRM-LKVPYIKSMENIEGGIQLEL--EVGEAEMKNR
2d32C           ----------------------------------------------------------------------
1e1tA           DNQELE---SLNIEVSVAGRM---MTRRIMGKASFVTLQDVGGRIQLYVAR-DSLPEGVYNDQFKKWDLG
2cj9B           PEGQGAKVTEWKLGEDRIEGIEVESFIIKVPADHELRMLKVPYIKSMENIEGGIQLELEVGEAEMKNRVP
3bjuC           VDISLTDFIQK-YSHLQPGDHLTDITLKVARIHIFYDLRGEGVKANSRNYKSEEEFIHINNKLRRGDIIG
2dq3A           ----------------------------------------------------------------EDEKDN
3e9hA           RTHKAEELFELYGDLSKEELEEQGRIMTKRGMGKAGFAHIQDVTGQIQIYVRQDDVGEQQYELFKISDLG
1eiyA           ---------------------------------------------------------------QNARDLE
3cmqA           ----------------------------------------------------------------------
1c0aA           --------RRDLGSLIFIDMRDREGIVQVFFDPDRADALKLASLRNEFCIQVTGTVRARDEKNINRDMAT
1bbuA           RDHTSDQLHADGKENEELEALNIGRMMTRRIMGKASFVLQDVGGRIQLYVARDDLPEGVYNEQFKKWDLG
1bbwA           RDHTSDQLHADGKENEELEALNIEVAVAGRMMASFVTLQDVGGRIQLY-VARDDLPEGVYNEQFKKWDLG
2du3B           ----------------------------------------------------------------------
3cw4A           ----------------------------------------------------------------------
2du5B           ----------------------------------------------------------------------
2bamB           ----------------------------------------------------------------------
2eiuC           ----------------------------------------------------------------------
1bhmB           ----------------------------------------------------------------------
3dsqA           ----------------------------------------------------------------------
3bamA           ----------------------------------------------------------------------
1e1oA           RDHTSDQLHEDAKDNQELESLNIGRMMTRRIMGKFVTLQDVGGRIQLYVARD-SLPEGVYNDQFKKWDLG
1b70A           ----------------------------------------------------------------------
2du4A           ----------------------------------------------------------------------
2eiuD           ----------------------------------------------------------------------
2bamA           ----------------------------------------------------------------------
3dsqB           ----------------------------------------------------------------SSFWTK
2du7A           ----------------------------------------------------------------------
2eiuE           ----------------------------------------------------------------------
2e3cA           ----------------------------------------------------------------------
11asA           ----------------------------------------------------------------------
2d6fD           ----------------------------------RTELTDSEPDH---DIVRNLRPTRAAFEEAMRKLHF
1bhmA           --------------------------------------------------------------FITDEAKE
3d1tB           --------------------------------------------------------------------NL
1b8aA           ----------------------------------------------------------------------
2e1bA           ISLFNKYVDGGEVKIWWE---GDRRYTQIRD--FEVIPCGGTHVKDIGHIKKLKRSSIGRGKQR------
3bjuB           ----------------------------------------------------------------------
2e7gA           --------KEDHARLRALNGLLYKALTDLLC-TPEVSQELYDLNVELS---KVSL-----------TPDF
3c2wC           ----------------------------------------------------------------------
2c7fB           ----------------------------------------------------------------------
2ddzE           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           MLSRVYGTAFPKKSXXXXXXXXXXXXKKRDHNKLGRELGIFTTDENVGQGLPLLMPKGARIIQTLQRWIE
2cimB           VPDRILTLLEEIEAAQYEHWNLLWQREPMEHPFKEDPTQAMMKEGWSSRGQWIHGPQSARIFRTFEKIVL
2cjaB           ILTLLEEKIEAAQYGAKAEHWNLLWQREPEHPFKEDPTQAKEGWLKSSRGQWIHGPQSARIFRTFEKIVL
1b76A           --------------------------SLDELVALCKRRGFIFQSSEIYGGVYDYGPLGVELKNNLKQAWW
1atiB           --------------------------SLDELVALCKRRGFIFQSSEIYGGVYDYGPLGVELKNNLKQAWW
2cjaA           ILTLLEEKIEAAQYGAKAEHWNLLWQREPEHPFKEDPTQAKEGWLKSSRGQWIHGPQSARIFRTFEKIVL
2cimA           VPDRILTLLEEKIGAKAEHWNLLWQREPMEHPFKEDPTQAMMKEGWLSRGQWIHGPQSARIFRTFEKIVL
1atiA           --------------------------KRRGFIFQSSEIY------GGLQGVYDYGPLGVELKNNLKQAWW
2dq0A           VPIRFWGKARVWKQSQGKMEYEILEWKPKLHVDLLEILGGADFARAAGSRFYYLLNEIVILDLALIRFAL
2cjbA           VPDRILTLLEEKIEAAQEHWNLLWQREPMEHPFKEDPTQAMMKEGWLKRGQWIHGPQSARIFRTFEKIVL
2cj9A           VPDRILTLLEEKEAAKAEHWNLLWQREPMEHPFKEDPTQAMMKEGWLSRGQWIHGPQSARIFRTFEKIVL
2du3A           AYLS-IGFSEVVNPLIVEDVHVKKQFGREALAVLDRCFYLATLPKPGISAEKIRQIEAITKREVDSKPLQ
2du5A           AYLS-IGFSEVVNPLIVEDVHVKKQFGREALAVLDRCFYLATLPKPGISAEKIRQIEAITKREVDSKPLQ
1adjA           ----------------------------------------------AVRGTKDLFGKELRMHQRIVATAR
3bjuD           KLQVMQGNPGKTKKGELSIIPYEITLLSPCLHMLPKDKETRYRQRYLDLILNDFVRQKFIIRSKIITYIR
1asyA           KIYTISETPEALPILLEDASRSEAEAEAAGLPVVNLDTRLDYR---VIDLRTVTNQAIFRIQAGVCELFR
2dq2A           VPIRFWGKARVWKQSQGKMEYEILEWKPKLHVDLLEILGGADFAKVSGSRFYYLLNEIVILDLALIRFAL
2cjbB           VPDRILTLLEEIEAAQYEHWNLLWQREPMEHPFKEDPTQAMMKEGGSSRGQWIHGPQSARIFRTFEKVLE
2d32C           ----------------------------------------------------------------------
1e1tA           DIIGARGTLFKTQTGELSIHCTELRLLTKALRPLPDQEVRYRQRY-LDLIANDKSRQTFVVRSKILAAIR
2cj9B           DRILTLLEEKIEAAQYAEHWNLLWQREPMEHPFKEDPTQAMMKEGWLSRGQWIHGPQSARIFRTFEKIVL
3bjuC           VQGNPGKTKKGELSIIPYEITLLSPCLHMLPHGLKDKETRYRQRY-LDLILNDFVRQKFIIRSKIITYIR
2dq3A           VEVRRWGEPRKFD------------FEPKPHWEIGERLGILDFKRGAGSRFTVIAGWGARLERALIN-FL
3e9hA           DIVGVRGTMFKKVGELSIKVSSYEFLTKALRPLPEKDIEQRYRQRYLDLIMNPESKKTFITRSLIIQSMR
1eiyA           ELKALKARYLGKKGLLTQEMKGLSALPLEERRKRGQELNAIKAALEVSLPGASLFSGGLHPITLMERELV
3cmqA           --------------------------YPQDDHSNLTRKVLT-------RVGRNLHNQQHHPLWLIKERVK
1c0aA           GEIEVLASSLTIINRADVLPLDSNHVNTEEARLKYRYLDLRRP----------EMAQRLKTRAKITSLVR
1bbuA           DILGAKGKLFKTKTGELSIHCTELRLLTKALRPLPDDQEARYRQRYLDLISNDESRNTFKVRSQILSGIR
1bbwA           DILGAKGKLFKTKTGELSIHCTELRLLTKALRPLPDQEARYRQRY-LDLISNDESRNTFKVRSQILSGIR
2du3B           --------------------------AWKAGKEILAERSPNEL----YPRVGFSFG-KEHPLFATIQRLR
3cw4A           ----------------------------------------------------------------------
2du5B           --------------------------AWKAGKEILAERSPNEL----YPRVGFSFG-KEHPLFATIQRLR
2bamB           -----------------------------TFTINNTEKNCNGVVPIKELCYTLLEDTYNWYREKPLDILK
2eiuC           ----------------------------------------------------------------------
1bhmB           ----------------------------KTFTINNTEKNCNGVVPIKELCYTLLEDTYNWYREKPLDILK
3dsqA           --------------------------GFSDALSRDRAFQGIEH-----QLMSQGKRHLEQLRTVKHRLLE
3bamA           ----------------------------KTFTINNTEKNCNGVVPIKELCYTLLEDTYNWYREKPLDILK
1e1oA           DIIGARGTLFKTQTGELSIHCTELRLLTKALRPLPDQEVRYR-QRYLDLIANDKSRQTFVVRSKILAAIR
1b70A           -------------------------------------------------GASLFSGGL-HPITLMERELV
2du4A           --------------------------AWKAGKEILAERSPNEL----YPRVGFSFGKE-HPLFATIQRLR
2eiuD           ----------------------------------------------------------------------
2bamA           ---------------------------------------------PIKELCYTLLEDTNWYREKPLDILK
3dsqB           VQYQRLKELNASGEQLEMGFSDALSRDRAFQGIEHQLMSQGK-----RHLEQLRTVKHRPALLELEEKLA
2du7A           --------------------------FETAWRETRALIKDKHIDNK-YPRLKPVYGKPHPVMETIERLRQ
2eiuE           ----------------------------------------------------------------------
2e3cA           --------------------------DESGKPFRELESELLSRRKK---DLQQYAEERENYLGKLEREIT
11asA           ----------------------------------------------------------QRQISFVKSHFS
2d6fD           HYENYHEETCLVE-----ADEEPPHPLNPEALEIAVTIALLLNMRVVDEFHTM-RKQVIDGSNTGGFQRT
1bhmA           LLSKDKLIQQAYNEVKTSICSPIWPATSKTFTINNTEKNCNGVVPIKELCYTLLEDTYNWYREKPLDILK
3d1tB           PINQVGIKDLRFP---------ITLKTAEGTQSTVARLTTVYLPAEQHSRFVALEQHTEAQLHRLTAEVA
1b8aA           ----------------------------------------------------------------------
2e1bA           ----------------------------------------------------------------------
3bjuB           ------------------------------------------------------VRQKFIIRSKIITYIR
2e7gA           SACRAYWKTTLSAEQNAHMEAVLQRSAAHMRHLLMSQQTLRNV-----PPIVFVQDKGNAALAELDQLLA
3c2wC           ----------------------------------------------------------------------
2c7fB           ----------------------------------------------------------------------
2ddzE           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           DEEQRRGYVLTKTPLMAKSDLYKISGHWDHYKDGMFVLGDEEKDSEVFALRPMTCPFQYAIYNSTQHSYR
2cimB           EELLEPGYREMIFPKLVTWEVWMKSGHAKGVYPEIYKLIKEKIAEPIGGMCYAQCPPFWMYVAGETLPNE
2cjaB           EELLEPLGYREIFPKLVTWEVWK-SGHAKGVYPEIYYVLIKEKIAEPIGGCYAQCPP-FWYVAGETLPNE
1b76A           RRNERDDMEGLDASVLTHRLVLHYSGHEATFADPMVDNAKARYWTPLAYLRPETAQGIVNFKNVLDATSR
1atiB           RRNERDDMEGLDASVLTHRLVLHYSGHEATFADPMVDWTPPRYFNMMFQLRPETAQGIFVNFKNVLATSR
2cjaA           EELLEPLGYREIFPKLVTWEVWK-SGHAKGVYPEIYYVLIKEKIAEPIGGCYAQCPPFWYVAGET-LPNE
2cimA           EELEPLGYREMIFPKLVTWEVWMKSGHAKGVYPEIYKLIKEKIAEPIGGMCYAQCPPFWMYVAGETLPNE
1atiA           RRNERDDMEGLDASVLTHRLVLHYSGHEATFADPMVDNWTPPRYFNMMFLRPETAQGIVNFKNVLDATSR
2dq0A           DRLIEKGFTPVIPPYMVRRFVEEGSTSFEDFEDVIY-----KVEDEDLYLIPTAEHPLAGMHANEILDGK
2cjbA           EELLEPGYREMIFPKLVTWEVWMKSGHAKGVYPVPTKLIKEKIAEPIGGMCYAQCPPFWMYVAGETLPNE
2cj9A           EELLEPGYREMIFPKLVTWEVWMKSGHAKGVYPEIYYLIKEKIAEPIGGMCYAQCPPFWMYVAGETLPNE
2du3A           EIFHRYKKGEIDGDDLSYLIAEVLDVDDITAVKILDEVFPEFKISSTLTLRSHMTTGWFITLSHIA-DKL
2du5A           EIFHRYKKGEIDGDDLSYLIAEVLDVDDITAVKILDEVFPEFKISSTLTLRSHMTTGWFITLSHIA-DKL
1adjA           KVLEAAGALELVTPIFEETQVFEKGVGAATDIVRKEMFTFQDRGGRSLTLRPEGTAAMVRAYLEHGMKVW
3bjuD           SFLDELGFLEIETPMMNIIPGGAVAKPFITYHNELD---------MNLYMRIAPELYH-------KMLVV
1asyA           EYLATKKFTEVHTPKLLGAPSEGGSSVFEVTYFKGK-----------AYLAQSPQFNK-------QQLIV
2dq2A           DRLIEKGFTPVIPPYMVRRFVEEGSTSFEDFEDVIYKVEDED-----LYLIPTAEHPLAGMHANEILDGK
2cjbB           ELLEPLGYREMIFPKLVTWEVWMKSGHAKGVYPEICPPQTRDPDYPIGGMCYAQCPPFWMYVAGETLPNE
2d32C           ----------------------------------------------------------IPDVSQALAWLE
1e1tA           QFMVARGFMEVETPMMQVIPGGASARPFITHHNALD---------LDMYLRIAPELYLK-------RLVV
2cj9B           EELEPLGYREMIFPKLVTWEVWMKSGHAKGVYPEIYKLIKEKIAEPIGGMCYAQCPPFWMYVAGETLPNE
3bjuC           SFLDELGFLEIETPMMNIIPGGAVAKPFITYHNELD---------MNLYMRIAPELYH-------KMLVV
2dq3A           DLHTKKGYKEICPPHLVKPEILIGTGQLPKFEEDLYKCERDN-----LYLIPTAEVPLTNLYREEILKEE
3e9hA           RYLDSHGYLEVETPMMHAVAGGAAARPFITHHNALD---------MTLYMRIAIELHL-------KRLIV
1eiyA           EIFRALGYQAVEGPEVESEFFNFDALHPARDMWDTFWLTGEEEVEGRLLLRTHTSPMQVRYM-----VAH
3cmqA           EHFYKQYVGRFGTPLFSVYDNLSPVVTTWQNFDSLLIPADHPRKKGDNYYLNRTHMLRAHTSAHQWDLLH
1c0aA           RFMDDHGFLDIETP--------MLTKATPEGARDYLVPSRVHKG------KFYALP--QSPQLFKQLLMM
1bbuA           QFMVNRGFMEVETPMMQVIPGGAAARPFITHHNALD---------LDMYLRIAPELYLKRLVV-------
1bbwA           QFMVNRGFMEVETPMMQVIPAARPFITHHNALDLDMYLRIAPE----LYLKRLVVGFERVFEINRNFRNE
2du3B           EAYLSIGFSEVVNPLIVEDVHVKKQFGREALAVLDRPKPNLKPISSTLTLRSHMTTGWFITLS-HIADKL
3cw4A           --------------------MWEINGPESLVNTYQWIIRNWE-----TVKIQWSQNPTMLYNMEFEPFQS
2du5B           EAYLSIGFSEVVNPLIVEDVHVKKQFGREALAVLDRPKPNLKPISSTLTLRSHMTTGWFITLS-HIADKL
2bamB           LEKKKGGPIDVYKEFIENSELKRVGMEFETGNISSAHRSMNK-----LLLGLKHGEIDLAII---LMPIK
2eiuC           ----------------------------------------------------------------------
1bhmB           LEKKKGGPIDVYKEFIENSELKRVGMEFETGNISSAHRSM-----NKLLLGLKHGEIDLAII---LMPIK
3dsqA           LEEKQQGFVQVVTPTIITKSALAKMTIGEPLFS------QVFWLDGKKCLRPMLAPNLYTLWR-ELERLW
3bamA           LEKKKGGPIDVYKEFIENSELKRVGMEFETGNISSAHRSMNK-----LLLGLKHGEIDLAII---LMPIK
1e1oA           QFMVARGFMEVETPMMQVIPGGASARPFITHHNALDLDMYLRIAPELYLKRLVVGGFERVFEINRNFRNE
1b70A           EIFRALGYQAVEGPEVESEFLNIPEHHPARDMWDTFWLTGEEEVEGRLLLRTHTSPMQVRY-----MVAH
2du4A           EAYLSIGFSEVVNPLIVEDVHVKKQFGREALAVLDRCFYLATLPSSTLTLRSHMTTGW-FITLSHIADKL
2eiuD           ----------------------------------------------------------------------
2bamA           LEKKKGGPIDVYKEFIENSELKRVGMEFETG--NISS---AHRSMNKLLLGLKHGEIDLAIIL---MPIK
3dsqB           KALHQQGFVQVVTPTIITKSALAKMTHPLFSQVFWLD--------GKKCLRPMLAPNLYTLWRE-LERLW
2du7A           -AYLRMGFEEMINPVIVDEMEIYKQFGPEAMAVLDRCFYLAGLPEKVEIIKNLGIDIDEEKKERLREVLH
2eiuE           ----------------------------------------------------------------------
2e3cA           RFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQ----IFRVDKNFCLRPMLAPNLYNYLRKLDRAL-
11asA           RQLERLGLIEVQAPILSRVGDGTQDNLSGAEKAVQV--KVKALPDAQFEVVHSLAKWKRQTLG---QHDF
2d6fD           GLVATDGHLETPQGTVKIENLEEDAARRIRETGDGVVFRLDRLG--IPLVEITTDPS--------MSDPQ
1bhmA           LEKKKGGPIDVYKEFIENSELKRVGMEFETGNISSAHRSMNK-----LLLGLKHGE---IDLAIILMPIK
3d1tB           LLDSRAGKISVSFPFFRKKTAPV-SGIRSLLDYDVSLTGEKDGAYGHSKVIPVTCPCSKEISQYGAHNQR
1b8aA           --------------------------IEIHTPKIIATATEGGTELFPMKYFEEDAFLAESPQLYKEIMMA
2e1bA           ----------------------------------------------------------------------
3bjuB           SFLDELGFLEIETPMMNIIPGGAVAKPFITYHNELD----------------MNLYMRIAPELYHKMLVV
2e7gA           VADSGPSS--------------------------------------------------------------
3c2wC           -------------------------------------------HPDDGIAALIPCDGALVMLGGRTLSIR
2c7fB           ----------------------------------------------------------------------
2ddzE           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           DLPVRFAETSTLFRNESSGEMHGLIRVRQFTLADGHIVCTPEQLEDEFKNTVDLVKYVMETLGIADDITY
2cimB           EIPVKVFDRSGTSHRYESGGIHGIERVDEFHRIEIVWIGTKEEVLKCAEELHDRYMHIFNDILD-IEWRK
2cjaB           EIPVKVFDSGTSHRYE-SGGIHGIERVDEFHRIEIVWIGTKEEVLKCAEELHDRYHIFNDILDIEWRKAR
1b76A           KLGFGIAQIGKAFRNEITPR-NFIFRVREFEQMEIEYFVRPGEDEYWHRYWVEERLKWWQEMGL-SRENL
1atiB           KLGFGIAQIGKAFRNEITPR-NFIFRVREFEQMEIEYFVRPGEDEYWHRYWVEERLKWWQEMGL-SRENL
2cjaA           EIPVKVFDSGTSHRYE-SGGIHGIERVDEFHRIEIVWIGTKEEVLKCAEELHDRYHIFNDILDI-EWRKA
2cimA           EIPVKVFDRSGTSHRYESGGIHGIERVDEFHRIEIVWIGTKEEVLKCAEELHDRYMHIFNDILD------
1atiA           KLGFGIAQIGKAFRNEITPR-NFIFRVREFEQMEIEYFVRPGEDEYWHRYWVEERLKWWQEMGL-SRENL
2dq0A           DLPLLYVGVSPCFRKEAGTDTKGIFRVHQFHKVEQFVYSRPEESWEWHEKIIRNAEELFQELEI-PYRVV
2cjbA           EIPVKVFDRSGTSHRYESGGIHGIERVDEFHRIEIVWIGTKEEVLKCAEELHDRYMHIFNDILD------
2cj9A           EIPVKVFDRSGTSHRYESGGIHGIERVDEFHRIEIVWIGTKEEVLKCAEELHDRYMHIF-----------
2du3A           PLPIKLFSIDRCFRRE---QGEDATRLYTYFSASCVLVDEELSVDDGKAVAEALLRQFGFE---------
2du5A           PLPIKLFSIDRCFRRE---QGEDATRLYTYFSASCVLVDEELSVDDGKAVAEALLRQFGFE---------
1adjA           PQPVRLWMAGPMFRAERPQKGR----YRQFHQVNYEALGSENP--ILDAEAVVLLYECLKELGL-RRLKV
3bjuD           GGIDRVYEIGRQFRNEGIDEFTTCEFYMAYADYHDLMEITEKMVSGMVKHITGSYKVTYHPDGPEGAYDV
1asyA           ADFERVYEIGPVFRAENSNTHRHMTEFTGLDMEMAFEEHYHEVLDTLSELFVFIFSELPKRFAH-EIELV
2dq2A           DLPLLYVGVSPCFRKEAGTDTKGIFRVHQFHKVEQFVYSRPEESWEWHEKIIRNAEELFQELEI-PYRVV
2cjbB           EIPVKVFDRSGTSHRYESGGIHGIERVDEFHRIEIVWIGTKEEVLKCAEELHDRYMHIF-----------
2d32C           KHPQALKGIQRGLERETDGTLATTGHPEALGSALTHKWITTDFAEALLEFITPVDGDIEHMLTFMRDLHR
1e1tA           GGFERVFEINRNFRNEGISVRH----NPEFTMMELYMAADYHDLIELTE---SLFRTLAQEVLGTTKVTY
2cj9B           EIPVKVFDRSGTSHRYESGGIHGIERVDEFHRIEIVWIGTKEEVLKCAEELHDRYMHIFNDILD------
3bjuC           GGIDRVYEIGRQFRNEGIDEFTTCEFYMAYADYHDLMEITEKMVSGMVKHITGSYKVTYHPDGPEGAYDV
2dq3A           NLPIYLTAYTPCYRREAGADIRGIIRQHQFDKVELVKIVHPDTSYDELEKLVKDAEEVLQLLGL-PYRVV
3e9hA           GGLEKVYEIGRVFRNEGI----STRHNPEFTMLELYEAADFRDIMKLTE---NLIAHIATEVLGTTKIQY
1eiyA           TPPFRIVVPGRVFRFEQT----DATHEAVFHQLEGLVVGEGIAMAHLKGAIYELAQALFG-----PDSKV
3cmqA           AGLDAFLVVGDVYRRDQIDSQH----YPIFHQLEAVRLFSKHELFAGI--KDGESLQLFEQSSRSAHKQE
1c0aA           SGFDRYYQIVKCFRDEDL----RADRQPEFTQIDVETSMTAPQVREVMEALVRHLWLEVKGVDL-GDFPV
1bbuA           GGFERVFEINRNFRNEGISVRH----NPEFTMMELYMAYADY--KDLIELTESLFRTLAQDILGKTEVTY
1bbwA           GISVHNPEFTMMELYMAYADYKDLIEL------------TESLFRTLAQDILGKTEVTYGDVTL------
2du3B           PLPIKLFSIDRCFRREQG---EDATRLYTYFSASCVLVDEELSVDDGKAVAEALLRQ----FGFENFRFR
3cw4A           LVPKAIRGQYSGFVRTLFQQMRGTFDTAQIIKLLPFAAAPPKQSRMQFSSFTVNVRGSGMRILV-----R
2du5B           PLPIKLFSIDRCFRREQG---EDATRLYTYFSASCVLVDEELSVDDGKAVAEALLRQ----FGFENFRFR
2bamB           QLAYYLTDRVTNFEELEPY--FELTEGQPFIFIGFNAEAYNSNVPLIPKGSDGMSKRSIKKWKD------
2eiuC           ----------------------------------------------------------------------
1bhmB           QLAYYLTDRVTNFEELEPY--FELTEGQPFIFIGFNAEAYNSNVPLIPKGSDGMSKRSIKKW--------
3dsqA           DKPIRIFEIGTCYRKESQGAQH----LNEFTMLNLTELGTPLE--ERHQRLEDMARWVLEAAGIREFELV
3bamA           QLAYYLTDRVTNFEELEPY--FELTEGQPFIFIGFNAEAYNSNVPLIPKGSDGMSKRSIKK---------
1e1oA           GISVHNPEFTMMELYMAYADYHDLIETESLFRTLAQEVLGTTKVTYGEHV--------FDFGKPFEKLTM
1b70A           TPPFRIVVPGRVFRFEQT----DATHEAVFHQLEGLVVGEGIAMAHLKGAIYELAQALFGPDSKVRFQPV
2du4A           PLPIKLFSIDRCFRREQGE---DATRLYTYFSASCVLVDEELSVDDGKAVAEALLRQFGF-----ENFRF
2eiuD           ----------------------------------------------------------------------
2bamA           QLAYYLTDRVTNFEELEPY--FELTEGQPFIGFNAEAYNSNVPLIPKGSDGMSKR---------------
3dsqB           DKPIRIFEIGTCYRKESQ----GAQHLNEFTMLNLTELGTPL--EERHQRLEDMARWVLEAAGIREFELV
2du7A           LYKKGAIDGDDLVFEIAKALNVSNEMGLKVLETAFPEFKDLKPESTTLTLRSHMTSGWFITLSLIKKRKL
2eiuE           ----------------------------------------------------------------------
2e3cA           PDPIKIFEIGPCYRKESDGKEH----LEEFTMLNFCQMGSGCTRENLESIITDFLNHLGIDFKIVGVYGD
11asA           SAGEGLYTHMKALRPDEDR--LSPLHSVYVDQWDWERVGDGERQFSTLK---STVEAIWAGIKATEAAVS
2d6fD           QLREVAYQIGQILRST------RVKRGLGTIRQDLNIIRDGARVEVK---GVQDLDLIPEIVEREVRQLS
1bhmA           QLAYYLTDRVTNFEELEPY--FELTEGQPFIFIGFNAEAYNSNVPLI-----------------------
3d1tB           TVSLTSDAEVGYVETQASCQLYGLLK-----RPDEKYVTEKAYENPKFV--EDVRDVATSLIADKRIKSF
1b8aA           SGLDRVYEIAPIFRAEEHNTTRHLNEAWSIDSEMAFIED----EEEVMSFLERLVAHAINYVREHNAKEL
2e1bA           ----------------------------------------------------------------------
3bjuB           GGIDRVYEIGRQFRNEGIDLTHTCEFYMAYADYHDLMEITEKMVSGMVKHITGSYKVTYHPDGPEGQAY-
2e7gA           ----------------------------------------------------------------------
3c2wC           GDFERQAPERDIYHTDNWGDCCGVLAIRFHRQESGWIFWFRHEEVHRIR---------------------
2c7fB           ------------------DEWNVWYHSNNEDANIMQNEPWRIAPPLLEDIYTFEDALLVGLMLITLMKHA
2ddzE           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           RFSKWDPNNTEKYINDPEAWENTQNIMREILNHLNIDFTEADDEAAFYGPKLDIQFKNVHGKEDTIITIQ
2cimB           ARVTNTVGTTDYEACLPYRGP----------DGEWLEFQNVSINGDKYPKGFNVKL--------------
2cjaB           V--------NTVGTTDYEACLPYRGPDGE-----WLEFQNVSINGDKYPKGFNVKLQSGDELWSGCSGVG
1b76A           VPYQQPPESSAHYAKATVDILY------------RFPHGSLELEGIAQRTDFDLGSHTKDQEAL-GITAR
1atiB           VPYQQPPESSAHYAKATVDIL------------YRFPHGSLELEGIAQRTDFDLGSHT-KDQEALGITAR
2cjaA           RVNTVGTTDYEACLPYRGPDGE------------WLEFQNVSINGDKYPKGFNVKLQSGDELWSGCSGVG
2cimA           -----IEWRKARVTNTVGTTDYEACLPYRGPDGEWLEFQNVSINGDKYPKGFNVKLQ-------------
1atiA           VPYQQPPESSAHYAKATVDIL------------YRFPHGSLELEGIAQRTDFDLGSHTKDQEALGI-TAR
2dq0A           NICTGDLGYVAAKKYDIEAWMPGQGKFREV----------------------------------VSASNC
2cjbA           ---------IEWRKARVTPWFMAQEGLLGLAEENTVGTTDYEACLPYRGPD-GEWLEFQN-------VSI
2cj9A           ----NDILDIEWRKARVTPWFMAQEGLLGLAEENTVGTTDYEACLPYRGPDGE-------WLEFQNVSIN
2du3A           ---NFRFRKDEKRSKYYIPDTQTEVFAFHPKLVGSSTKYSDGWIEIATFGIYSPTALAEYDIPYPVMNLG
2du5A           ---NFRFRKDEKRSKYYIPDTQTEVFAFHPKLVGSSTKYSDGWIEIATFGIYSPTALAEYDIPYPVMNLG
1adjA           KLSSVGDPEDRYNAYLREVLSPHREALSEDSKDSKSERDQALLKELGVRPMLDFLGEEARAHLKEVERHL
3bjuD           DFTP-----PFRRINMVEELEKALGMKLPETNLFETEETRKILDDICVAKAVECPPPRTTARLLDKLVGE
1asyA           RKQYPVEEFKLAAGKEIGDFEDLSTENEKFLGKLVRDKYDTDFYILDKFPLEIRPFYTMPDPANPKYSNS
2dq2A           NICTGDLGYVAAKKYDIEAW-----------------------------------MPGQGKFREVVSASN
2cjbB           ----NDILDIEWRKARVTPWFMAQEGLLGLAEENTVGTTDYEACLPYRGPDG-------EWLEFQNVSIN
2d32C           Y--------TARNMGDERMWPLSMPSYIADIELAQYGTSNTGRFKTLYREGLKNRYG---ALMQTISGVH
1e1tA           GEHVFDFGKPFEKLTMREAIKTDMADLDNFDAAKALAESIGITVEKSWGLGRIVTEIFDEVAEAHLIQPT
2cj9B           ---------IEWRKARVTPWFMAQEGLLGLAEENTVGTTDYEACLPYRGPDGE-------WLEFQNVSIN
3bjuC           DFTP-----PFRRINMVEELEKALGMKLPETNLFETEETRKILDDICVAKAVECPPPRTTARLLDKLVGE
2dq3A           ELCTGDLGFSAAKTYDIEVWFPSQNKYREISSCSNCEDFQARRNTRFKDSKTGKNRFVHTLNGSGLAVGR
3e9hA           GEHLVDLTPEWRRLHMVDAIKEYVGVSDEEARELAKEHGVEVAPHMTFGHIVNEFFEQKVEDKLIQPTFI
1eiyA           RFQPVYFPFVEPGAQFAVWWPEGGKWLELGGAGMVHPKVFQAVDAYRERLGLPPAYRGVTGFAFGLGVER
3cmqA           TH------TMEAVKLVEFDLKQTLTRLMAHLFGDELEIRWVDCYFPFTHPSFEMEINFHGEVLGCGVMEQ
1c0aA           MTFAEAERRYGSDKPDLRNPMELTDVADLLKSVEFAVF--------AGPANDPKGRVAALRVPGGASLTR
1bbuA           GDVTLDFGKPFEKLTMREAIKTDMADLDNFDSAKAIAESIGIHVEKSWGLGRIVTEIFEEVAEAHLIQPT
1bbwA           DFGKPFEKLTMREAIKKYRPETDMADLDNFDSAKAIAESIGIHVEKSWGLGRIVTEIFEEVAEAHLIQPT
2du3B           KDEKRSKYYIPDTQTEVFAFHPKLVGSSTKYSDGWI-------EIATFG-IYSPTALAEYDIPYPVMNLG
3cw4A           GNSPVFNYNKATKRLTVLGKDAGTLTEDPDEGTAGVESAVLRGFLILGKEDKRY-----GPALSINELSN
2du5B           KDEKRSKYYIPDTQTEVFAFHPKLVGSSTKYSDGWI-------EIATFG-IYSPTALAEYDIPYPVMNLG
2bamB           ----------------------------------------------------------------------
2eiuC           -------------------------------------------EGKVEGVPGNYPLT-----AENLFRIG
1bhmB           ----------------------------------------------------------------------
3dsqA           TESSVVY---GDTVDVMKGDLELASGAMGPHFLDEKWEIFDPWVGLGFGLERLLMIREGTQHVQSMAR-S
3bamA           ----------------------------------------------------------------------
1e1oA           REAI------KKYRPETDMADLDNFDAAKALAESIGITVEKSWGLGRIVTEIFDEVAEAHLIQPTFITEY
1b70A           YF-----PFVEPGAQFAVWWPEGGKWLELGGAGMVHPKVFQAVDAYRERLGLPPAYRGVTGFAFGLGVER
2du4A           RKDEKRSKYYIPDTQTEVFAFHPKLVGSST-------KYSDGWIEIATFGIYSPTALAEYDIPYPVMNLG
2eiuD           ----------------------------------------------------EGKVEGVPGNYPLTARIG
2bamA           ----------------------------------------------------------------------
3dsqB           TESSVVG---DTVDVMKGDLELASGAMGPHFLDEKWEIFDPWVGLGFGLERL------------------
2du7A           PLKLFSIDRCFRREQREDRSHLMSYHSASCFGFTKFKFKPDEKKSKYYTPETQTEYHPKLGEWIEVATFV
2eiuE           -------------------------------------------------PAIFTKVEGVPGNYPLTARIG
2e3cA           TLDVMPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAAGSYYNGISTNL----------------
11asA           EEFGLAPFLPDQIHFVHSQE--------------------------------------------------
2d6fD           LVEIRDTLQERGAVVEDKIFD---VSEVFADTESRIISSAESVLAVKLRGFDGL-IGVEIQPGRRLGTEM
1bhmA           ----------------------------------------------------------------------
3d1tB           VVES---ENFESIHNHSAYAY-------------------------------------------------
1b8aA           DILNFELEEPEILGDLGKEIPWGEDIDTEGERLLGKYMMENENAPLYQYPSEAKPFYIMKYDNKPEICRA
2e1bA           ----------------------------------------------------------------------
3bjuB           ---DVDFTPPFRRINMVEELEKALGMKLPETNLFETEETRKILDDICVAKAVECPPPRTTARLLDLVGEF
2e7gA           ----------------------------------------------------------------------
3c2wC           ----------------------------------------------------------------------
2c7fB           DRIKIACLAQLINVIAPIVTERNGGAAWRQTIFYPFMHASKYGRGIVLQPVINSPLHDTSKHEDVTDIES
2ddzE           ------LFWHPDILLASSLQKLLIARLVELLWNYGIEASRRGDDIYVNGRKLVSPVSIKIH-----IGLN


                         *         .         .         .         .         +         .:560
query           IDFALAERFGMYYIDKDGEKKRPYIIHRSSIGCYERTLAMLIEKYAGALPTWIAPVQAKVLPLSDKYADY
2cimB           -------------------QSGDELWSGCSGVGLERWAAVFLAQKGLDPANWPEEFRNRVGEMPK-GIRF
2cjaB           LERWAAVFLAQKG----LDPANWPEEFRNRVGEPKG----------------------------------
1b76A           VLRNEHSTQRLAYRDPETGKWFVPYVIEPSAGVDRGVLALLAEAFTREELPQLAPIKVAVIPLVKNITEY
1atiB           VLRNEHSTQRLAYRDPETGKWFVPYVIEPSAGVDRGVLALLAEAFTREELPQLAPIKVAVIPLVKNITEY
2cjaA           LERWAAVFLAQKG----LDPANWPEEFRNRVGEPKG----------------------------------
2cimA           --------------------SGDELWSGCSGVGLERWAAVFLAQKGLDPANWPEEFRNRVGEMPK-GIRF
1atiA           VLRNEHSTQRLAYRDPETGKWFVPYVIEPSAGVDRGVLALLAEAFTREELPNGAPIKVAVIPLVKNITEY
2dq0A           TDWQ-ARRLNIRFRDRTDEKPRYVHTLNSTAIATSRAIVAILENHQEEIPKVLWKYTGFK----------
2cjbA           NGDKYPKGFNVKL------QSGDELWSGCSGVGLERWAAVFLAQKGLDPANWPEEFRNRVGEMPK-----
2cj9A           GDK-------YPKGFNVKLQSGDELWSGCSGVGLERWAAVFLAQKGLDPANWPEEFRNRVGEMPK-----
2du3A           LGVERLAMILYGYDDVR-----KMVYPQIHGEIKLSDLDIAREIKVKEVPQT-AVGLKIAQSIVETAEKH
2du5A           LGVERLAMILYGYDDVR-----KMVYPQIHGEIKLSDLDIAREIKVKEVPQT-AVGLKIAQSIVETAEKH
1adjA           ERLSVPYELEPALVRGLFEVHHEEIGAQSALGGGGRYDGLSELLGGPRVPGVEKGPDLYLIPLTEEAVAE
3bjuD           FLEVTCINPTFICDHPQIMSPAKWHRSKEGLTERFELFVMKKEICNAYTELNDPMRQRQLFEEQAKAKAA
1asyA           YDFFMEEILSGAQRIHDHALLQERMKAHGLSPEDPGLKDYCDGFSYGCPPHAGGGIG-------------
2dq2A           CTDWQARRLNIRFRDRTDEKPRYVHTLNSTAIATSRAIVAILENHQEEDGTVRIPGFKEIVPVE------
2cjbB           GDKY-PKGFNVKL------QSGDELWSGCSGVGLERWAAVFLAQKGLDPANWPEEFRNRVGEMPK-----
2d32C           YNFSLPMAFWQAKISGADAKEKISAGYFRVIRNYYRFGWVIPYLF-GASPAISSSFSLPFEKTMYYLTSL
1e1tA           FITEYPAEVSPLARRND-VNPEITDRFEFFIGGREIGNGFSELNDAEDQAERFQEQVNAKAA--------
2cj9B           GDKY-PKGFNVKLQS------GDELWSGCSGVGLERWAAVFLAQKGLDPANWPEEFRNRVGEMPK-----
3bjuC           FLEVTCINPTFICHPQIMSPLAKWHRSKEGLTERFELFVMKKEICNAYTELNDPMRQRQLFEEQAKAKAA
2dq3A           TLAAILENYQ----QEDGSVVVPEVLRD------------------------------------------
3e9hA           YGHPVEISPLAKKNPDDPRFTDRFLFIVGREHANAFTELNDPIDQRQRFEEQLKEREQGNDEAHEMDEDF
1eiyA           LAMLRYGIPD----IRYFFGGRLKFLE-------------------------------------------
3cmqA           QLVNSAGAQDRIGWAFGLGLERLAMILYDIPDIRLFWCEDERFLKQFCVSNINQKVKFQPLNYAENDFYD
1c0aA           KQIDEYGNFVKIYGAKGLAYIKVNERAKGLEGINSPVAKFLNAEIIEDILDRTAAQD-------------
1bbuA           FITEYPAEVSPLARRND-VNPEITDRFEFFIGGREIGNGFSELNDAEDQAQRFLDQV-------------
1bbwA           FITEYPAEVSPLARRNDVNPEITDRFEFFIGGREIGNGFSELNDA-------------------------
2du3B           LGV-----------------ERLAMILYGYDDVRKMVYPQIHGEIKLSDLDIAREIKVKEVPQTAVGLKI
3cw4A           LAKGEKANVLIGGDVVLVMKRKR-----------------------------------------------
2du5B           LGV-----------------ERLAMILYGYDDVRKMVYPQIHGEIKLSDLDIAREIKVKEVPQTAVGLKI
2bamB           ----------------------------------------------------------------------
2eiuC           LALCTLWILDKEIEEPTLSIPETNFVTLALSVGFMNAGGSVNVGKGGDIKLFLQKGEIYVLEFSETDIKK
1bhmB           ----------------------------------------------------------------------
3dsqA           LSYLDGVRL-------------------------------------------------------------
3bamA           ----------------------------------------------------------------------
1e1oA           PAEVSPLARRNDVNPEITDRFEFFIGGREIGNGFSE----------------------------------
1b70A           LA---MLRYGIPDIYFFGGRLKFLEQFKGVL---------------------------------------
2du4A           LGV-----------------ERLAMILYGYDDVRKMVYPQIHGEIKLSDLDIAREIKVKEVPQTAVGLKI
2eiuD           LALCTLWILDKEIEEPTLSIPETNFVTLALSVGFMNAGGSVNVGKGGDIKLFLQKGEIYVLEFQPLSETD
2bamA           ----------------------------------------------------------------------
3dsqB           ----------------------------------------------------------------------
2du7A           YSPIALAKYNIDVPVMNLGLGVERLAM----------IIYGYEDVRAMVYPQFYEYRLSDRDIAGMIRVD
2eiuE           LALCTLWILDKEIEEPTLSIPETNFVTLALSVGFMNAGGSVNVGKGGDIKLFLQKGEIYVLEFQPLSETD
2e3cA           ----------------------------------------------------------------------
11asA           ----------------------------------------------------------------------
2d6fD           ADYAKKRGVSG-----------------------------------------------------------
1bhmA           ----------------------------------------------------------------------
3d1tB           ----------------------------------------------------------------------
1b8aA           FDLEYRGVEISSGGQREHRHDILVEQIKEKGLNPESFEFYLKAFRYGMPPHGGFGLGAERLIKQMLDLPN
2e1bA           ----------------------------------------------------------------------
3bjuB           LEVTCINPTFICDHPQIMSPLAKWHRSKEGLTERFELFVMKKEICNAYTELNDPMRQRQLFEEQAKAKAA
2e7gA           ----------------------------------------------------------------------
3c2wC           ----------------------------------------------------------------------
2c7fB           VAIYNEEEVTIFAVNRNIHEDIVLVSDVRGMRLLEHIV--------------------------------
2ddzE           VKTVG-VPPGVDAIGLEELGIDPTEFMERSAKALVEEIEKVRKD--SLKVRWV-----------------


                         .         .         .         *         .         .         .:630
query           ANXXXXXXXXXXXXXXADHRAEKIGYKIREARLERTPYILVVGEKEAENKEVSVRSRKNGEEGAMPLADF
2cimB           ----------------------------------------------------------------------
2cjaB           ----------------------------------------------------------------------
1b76A           AKRLKARLLALGLGRVLYEDTGNIGKAYRRHDEVGTPFAVTVDYDTIGQSKVTVRDRDTMEQIRLHVDEL
1atiB           AKRLKARLLALGLGRVLYEDTGNIGKAYRRHDEVGTPFAVTVDYDTIGQSKVTVRDRDTMEQIRLHVDEL
2cjaA           ----------------------------------------------------------------------
2cimA           ----------------------------------------------------------------------
1atiA           AKRLKARLLALGLGRVLYEDTGNIGKAYRRHDEVGTPFAVTVDYDTIGQSKVTVRDRDTMEQIRLHVDEL
2dq0A           ----------------------------------------------------------------------
2cjbA           ----------------------------------------------------------------------
2cj9A           ----------------------------------------------------------------------
2du3A           A-------SEPSPCSFLAFEGEMMGRNVRVYVVEEEENTKLCGPAYANEVVVYKGDIYGIPKTKKWRSFF
2du5A           A-------SEPSPCSFLAFEGEMMGRNVRVYVVNENENTKLCGPAYANEVVVYKGDIYGIPKTKKWRSFF
1adjA           AFYLAEALRPRLRAEY-ALAPRKPAKGLEEALKRGAAFAGFLGEDELRAGEVTLKRLATGEQVRLSREEV
3bjuD           GDDEAMFIDENFCTALEYGLPPTAGWGMGIDRV----AMFLTDSNNIKEVLLFPAMK-------------
1asyA           ----------------------------------------------------------------------
2dq2A           ----------------------------------------------------------------------
2cjbB           ----------------------------------------------------------------------
2d32C           RLSDLGYTNQSNLGITFNDLYEYVAGLKQAIKTPSEEYAKIGIEKDGKRLQINSNVLQIENELYAPIRPK
1e1tA           ----------------------------------------------------------------------
2cj9B           ----------------------------------------------------------------------
3bjuC           GDDEAMFIDENFCTALEYGLPPTAGWGMGIDRV----AMFLTDSNNIKEVLLFPAMK-------------
2dq3A           ----------------------------------------------------------------------
3e9hA           LE--------------------------------------------------------------------
1eiyA           ----------------------------------------------------------------------
3cmqA           LVRTIGGDLVEKVDLIDKFVHPKTHKTSHCYRITYRHMERTLSQREVRHIHQALQEAAVQLLGV------
1c0aA           ----------------------------------------------------------------------
1bbuA           ----------------------------------------------------------------------
1bbwA           ----------------------------------------------------------------------
2du3B           AQSIVETAEKHASEPSPCFEGEMMGRNVRVYVVEEEENTKLCGPAYANEVVVYKG----DIYGIPKTKKW
3cw4A           ----------------------------------------------------------------------
2du5B           AQSIVETAEKHASEPSPCFEGEMMGRNVRVYVVNENENTKLCGPAYANEVVVYKG----DIYGIPKTKKW
2bamB           ----------------------------------------------------------------------
2eiuC           LE--------------------------------------------------------------------
1bhmB           ----------------------------------------------------------------------
3dsqA           ----------------------------------------------------------------------
3bamA           ----------------------------------------------------------------------
1e1oA           ----------------------------------------------------------------------
1b70A           ----------------------------------------------------------------------
2du4A           AQSIVETAEKHASEPSPCFEGEMMGRNVRVYVVEEEENTKLC--GPAYANEVVVYKGDIYGIPKTKKWR-
2eiuD           IK--KLESILFGRAPIPKKTGEDIGFK-------------------------------------------
2bamA           ----------------------------------------------------------------------
3dsqB           ----------------------------------------------------------------------
2du7A           KVPILDEFYNFANELIDISPCSVEVKREFNFNGERRVIKVEIFENEPNKKLLGPSVLNEVYVYDGNIYGI
2eiuE           IK--KLESILFGRAPIPKKTGEDIGFK-------------------------------------------
2e3cA           ----------------------------------------------------------------------
11asA           ----------------------------------------------------------------------
2d6fD           ----------------------------------------------------------------------
1bhmA           ----------------------------------------------------------------------
3d1tB           ----------------------------------------------------------------------
1b8aA           I---------------------------------------------------------------------
2e1bA           ----------------------------------------------------------------------
3bjuB           GDDEAMFIDENFCTALEYGLPPTAGWGMGIDRV----AMFLTDSNNIKEVLLFPAMK-------------
2e7gA           ----------------------------------------------------------------------
3c2wC           ----------------------------------------------------------------------
2c7fB           ----------------------------------------------------------------------
2ddzE           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           VNRIVLEIANREN
2cimB           -------------
2cjaB           -------------
1b76A           EGFLRERL-----
1atiB           EGFLRERL-----
2cjaA           -------------
2cimA           -------------
1atiA           EGFLRERL-----
2dq0A           -------------
2cjbA           -------------
2cj9A           -------------
2du3A           EEGVPTGIRY---
2du5A           EEGVPTGIRY---
1adjA           PGYLLQALG----
3bjuD           -------------
1asyA           -------------
2dq2A           -------------
2cjbB           -------------
2d32C           RVTRSGESPS---
1e1tA           -------------
2cj9B           -------------
3bjuC           -------------
2dq3A           -------------
3e9hA           -------------
1eiyA           -------------
3cmqA           -------------
1c0aA           -------------
1bbuA           -------------
1bbwA           -------------
2du3B           RSFFEEGVPTGIR
3cw4A           -------------
2du5B           RSFFEEGVPTGIR
2bamB           -------------
2eiuC           -------------
1bhmB           -------------
3dsqA           -------------
3bamA           -------------
1e1oA           -------------
1b70A           -------------
2du4A           -------------
2eiuD           -------------
2bamA           -------------
3dsqB           -------------
2du7A           PPTF---------
2eiuE           -------------
2e3cA           -------------
11asA           -------------
2d6fD           -------------
1bhmA           -------------
3d1tB           -------------
1b8aA           -------------
2e1bA           -------------
3bjuB           -------------
2e7gA           -------------
3c2wC           -------------
2c7fB           -------------
2ddzE           -------------