[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for cper0:BAB82333.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3eetA.bssp"
#ERROR : Can't open dsspfile "3eetB.bssp"
#ERROR : Can't open dsspfile "3cnvB.bssp"
#ERROR : Can't open dsspfile "3cnvA.bssp"
#ERROR : Can't open dsspfile "3ddvB.bssp"
#ERROR : Can't open dsspfile "3cnvD.bssp"
#ERROR : Can't open dsspfile "3cnvC.bssp"
#ERROR : Can't open dsspfile "3ddvD.bssp"
#ERROR : Can't open dsspfile "3bwgB.bssp"
#ERROR : Can't open dsspfile "2di3B.bssp"
#ERROR : Can't open dsspfile "2di3A.bssp"
#ERROR : Can't open dsspfile "3edpA.bssp"
#ERROR : Can't open dsspfile "3edpB.bssp"
#ERROR : Can't open dsspfile "3bwgA.bssp"
#ERROR : Can't open dsspfile "3ddvA.bssp"
#ERROR : Can't open dsspfile "3bwgC.bssp"
#ERROR : Can't open dsspfile "1e2xA.bssp"
#ERROR : Can't open dsspfile "3ddvC.bssp"
#ERROR : Can't open dsspfile "3by6E.bssp"
#ERROR : Can't open dsspfile "3by6B.bssp"
#ERROR : Can't open dsspfile "3by6D.bssp"
#ERROR : Can't open dsspfile "3by6A.bssp"
#ERROR : Can't open dsspfile "3by6C.bssp"
#ERROR : Can't open dsspfile "2b7oA.bssp"
#ERROR : Can't open dsspfile "3c7jB.bssp"
#ERROR : Can't open dsspfile "3c7jA.bssp"
#ERROR : Can't open dsspfile "2b7oB.bssp"
#ERROR : Can't open dsspfile "1aoyA.bssp"
#ERROR : Can't open dsspfile "2ek5A.bssp"
#ERROR : Can't open dsspfile "2du9A.bssp"
#ERROR : Can't open dsspfile "2ek5B.bssp"
#ERROR : Can't open dsspfile "3d0sB.bssp"
#ERROR : Can't open dsspfile "2ek5C.bssp"
#ERROR : Can't open dsspfile "3d0sA.bssp"
#ERROR : Can't open dsspfile "2d45B.bssp"
#ERROR : Can't open dsspfile "2acjC.bssp"
#ERROR : Can't open dsspfile "2d45A.bssp"
#ERROR : Can't open dsspfile "1bibA.bssp"
#ERROR : Can't open dsspfile "1c4kA.bssp"
#ERROR : Can't open dsspfile "2co5A.bssp"
#ERROR : Can't open dsspfile "2dk8A.bssp"
#ERROR : Can't open dsspfile "2acjA.bssp"
#ERROR : Can't open dsspfile "2acjD.bssp"
#ERROR : Can't open dsspfile "2b0lA.bssp"
#ERROR : Can't open dsspfile "1b1bA.bssp"
#ERROR : Can't open dsspfile "2d45D.bssp"
#ERROR : Can't open dsspfile "2acjB.bssp"
#ERROR : Can't open dsspfile "2b0lB.bssp"
#ERROR : Can't open dsspfile "1bi0A.bssp"
#ERROR : Can't open dsspfile "1biaA.bssp"
#ERROR : Can't open dsspfile "1bi2B.bssp"
#ERROR : Can't open dsspfile "1bi3B.bssp"
#ERROR : Can't open dsspfile "2dtrA.bssp"
#ERROR : Can't open dsspfile "1ddnA.bssp"
#ERROR : Can't open dsspfile "2e1nB.bssp"
#ERROR : Can't open dsspfile "1c0wB.bssp"
#ERROR : Can't open dsspfile "1bi2A.bssp"
#ERROR : Can't open dsspfile "1dprA.bssp"
#ERROR : Can't open dsspfile "3cuoD.bssp"
#ERROR : Can't open dsspfile "1dtr-.bssp"
#ERROR : Can't open dsspfile "3cuoC.bssp"
#ERROR : Can't open dsspfile "2co5B.bssp"
#ERROR : Can't open dsspfile "1c0wD.bssp"
#ERROR : Can't open dsspfile "3cuoA.bssp"
#ERROR : Can't open dsspfile "2dqlA.bssp"

## Summary of PDB Search
:241
    4e-38  19%  3eetA  [x.x.x] PUTATIVE GNTR-FAMILY TRANSCRIPTIONAL REGULATOR
    3e-37  18%  3eetB  [x.x.x] PUTATIVE GNTR-FAMILY TRANSCRIPTIONAL REGULATOR
    2e-31  23%  3cnvB  [x.x.x] PUTATIVE GNTR-FAMILY TRANSCRIPTIONAL REGULATOR
    5e-30  22%  3cnvA  [x.x.x] PUTATIVE GNTR-FAMILY TRANSCRIPTIONAL REGULATOR
    6e-30  20%  3ddvB  [x.x.x] TRANSCRIPTIONAL REGULATOR (GNTR FAMILY)
    1e-29  21%  3cnvD  [x.x.x] PUTATIVE GNTR-FAMILY TRANSCRIPTIONAL REGULATOR
    4e-29  22%  3cnvC  [x.x.x] PUTATIVE GNTR-FAMILY TRANSCRIPTIONAL REGULATOR
    4e-28  20%  3ddvD  [x.x.x] TRANSCRIPTIONAL REGULATOR (GNTR FAMILY)
    3e-27  20%  3bwgB  [x.x.x] UNCHARACTERIZED HTH-TYPE TRANSCRIPTIONAL
    3e-27  15%  2di3B  [x.x.x] BACTERIAL REGULATORY PROTEINS, GNTR FAMILY
    1e-26  14%  2di3A  [x.x.x] BACTERIAL REGULATORY PROTEINS, GNTR FAMILY
    7e-26  18%  3edpA  [x.x.x] LIN2111 PROTEIN
    9e-26  18%  3edpB  [x.x.x] LIN2111 PROTEIN
    1e-25  18%  3bwgA  [x.x.x] UNCHARACTERIZED HTH-TYPE TRANSCRIPTIONAL
    7e-23  23%  3ddvA  [x.x.x] TRANSCRIPTIONAL REGULATOR (GNTR FAMILY)
    1e-22  19%  3bwgC  [x.x.x] UNCHARACTERIZED HTH-TYPE TRANSCRIPTIONAL
    1e-22  18%  1e2xA  [a.4.5 - a.78.1] FATTY ACID METABOLISM REGULATOR PROTEIN
    1e-21  23%  3ddvC  [x.x.x] TRANSCRIPTIONAL REGULATOR (GNTR FAMILY)
    3e-20  21%  3by6E  [x.x.x] PREDICTED TRANSCRIPTIONAL REGULATOR
    3e-19  22%  3by6B  [x.x.x] PREDICTED TRANSCRIPTIONAL REGULATOR
    8e-19  22%  3by6D  [x.x.x] PREDICTED TRANSCRIPTIONAL REGULATOR
    1e-18  25%  3by6A  [x.x.x] PREDICTED TRANSCRIPTIONAL REGULATOR
    3e-18  22%  3by6C  [x.x.x] PREDICTED TRANSCRIPTIONAL REGULATOR
    4e-18  10%  2b7oA  [x.x.x] 3-DEOXY-D-ARABINO-HEPTULOSONATE 7-PHOSPHATE
    6e-18  23%  3c7jB  [x.x.x] TRANSCRIPTIONAL REGULATOR, GNTR FAMILY
    8e-18  23%  3c7jA  [x.x.x] TRANSCRIPTIONAL REGULATOR, GNTR FAMILY
    9e-18  10%  2b7oB  [x.x.x] 3-DEOXY-D-ARABINO-HEPTULOSONATE 7-PHOSPHATE
    2e-14   4%  1aoyA  [x.x.x] ARGININE REPRESSOR
    2e-14  20%  2ek5A  [x.x.x] PREDICTED TRANSCRIPTIONAL REGULATORS
    4e-14  20%  2du9A  [x.x.x] PREDICTED TRANSCRIPTIONAL REGULATORS
    4e-14  18%  2ek5B  [x.x.x] PREDICTED TRANSCRIPTIONAL REGULATORS
    3e-13  12%  3d0sB  [x.x.x] TRANSCRIPTIONAL REGULATORY PROTEIN
    5e-13  28%  2ek5C  [x.x.x] PREDICTED TRANSCRIPTIONAL REGULATORS
    3e-12  12%  3d0sA  [x.x.x] TRANSCRIPTIONAL REGULATORY PROTEIN
    2e-09  18%  2d45B  [x.x.x] METHICILLIN RESISTANCE REGULATORY PROTEIN MECI
    4e-09  15%  2acjC  [x.x.x] DOUBLE-STRANDED RNA-SPECIFIC ADENOSINE DEAMINASE
    5e-09  18%  2d45A  [x.x.x] METHICILLIN RESISTANCE REGULATORY PROTEIN MECI
    9e-09  11%  1bibA  [x.x.x] BIR A[MASQUE : MEMB(X) 45 / COIL(x) 0]
    2e-08   7%  1c4kA  [c.23.1 - c.67.1 - d.125.1] PROTEIN (ORNITHINE
    3e-08  18%  2co5A  [x.x.x] VIRAL PROTEIN F93
    3e-08  11%  2dk8A  [x.x.x] DNA-DIRECTED RNA POLYMERASE III 39 KDA
    4e-08  12%  2acjA  [x.x.x] DOUBLE-STRANDED RNA-SPECIFIC ADENOSINE DEAMINASE
    7e-08  16%  2acjD  [x.x.x] DOUBLE-STRANDED RNA-SPECIFIC ADENOSINE DEAMINASE
    1e-07  14%  2b0lA  [x.x.x] GTP-SENSING TRANSCRIPTIONAL PLEIOTROPIC
    2e-07  16%  1b1bA  [a.4.5 - a.76.1] PROTEIN (IRON DEPENDENT REGULATOR)
    2e-07  18%  2d45D  [x.x.x] METHICILLIN RESISTANCE REGULATORY PROTEIN MECI
    3e-07  16%  2acjB  [x.x.x] DOUBLE-STRANDED RNA-SPECIFIC ADENOSINE DEAMINASE
    3e-06  19%  2b0lB  [x.x.x] GTP-SENSING TRANSCRIPTIONAL PLEIOTROPIC
    6e-06  24%  1bi0A  [x.x.x] DIPHTHERIA TOXIN REPRESSOR
    7e-06  19%  1biaA  [x.x.x] BIRA BIFUNCTIONAL PROTEIN[MASQUE : MEMB(X) 45 /
    7e-06  24%  1bi2B  [a.4.5 - a.76.1] DIPHTHERIA TOXIN REPRESSOR
    1e-05  21%  1bi3B  [a.4.5 - a.76.1] DIPHTHERIA TOXIN REPRESSOR
    1e-05  24%  2dtrA  [x.x.x] DIPHTHERIA TOXIN REPRESSOR
    3e-05  24%  1ddnA  [a.4.5 - a.76.1] DIPHTHERIA TOX REPRESSOR
    8e-05  11%  2e1nB  [x.x.x] PEX
    1e-04  24%  1c0wB  [a.4.5 - a.76.1 - b.34.1] DIPHTHERIA TOXIN REPRESSOR
    1e-04  19%  1bi2A  [a.4.5 - a.76.1 - b.34.1] DIPHTHERIA TOXIN REPRESSOR
    2e-04  22%  1dprA  [a.4.5 - a.76.1] DIPHTHERIA TOX REPRESSOR
    2e-04  13%  3cuoD  [x.x.x] UNCHARACTERIZED HTH-TYPE TRANSCRIPTIONAL
    2e-04  20%  1dtr-  [x.x.x] DIPHTHERIA TOXIN REPRESSOR
    2e-04  13%  3cuoC  [x.x.x] UNCHARACTERIZED HTH-TYPE TRANSCRIPTIONAL
    2e-04  16%  2co5B  [x.x.x] VIRAL PROTEIN F93
    3e-04  21%  1c0wD  [a.4.5 - a.76.1 - b.34.1] DIPHTHERIA TOXIN REPRESSOR
    4e-04  13%  3cuoA  [x.x.x] UNCHARACTERIZED HTH-TYPE TRANSCRIPTIONAL
    7e-04  16%  2dqlA  [x.x.x] PEX PROTEIN
:241

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MFKRSRGIALYHQLETELIDLINSGELKENDKLPSERELCEQYNVSRTTARQAIGELERKEYVYKVHGKG
3eetA           ---------AYLRVAGDLRKKIVDGSLPPHTRLPSQARIREEYGVSDTVALEAR-KVLAEGLVEGRSGTY
3eetB           ---------FYLRVAGDLRKKIVDGSLPPHTRLPSQARIREEYGVSDTVALEARKVLAEGLVETYVRERP
3cnvB           ----------------------------------------------------------------------
3cnvA           ----------------------------------------------------------------------
3ddvB           ----------------------------------------------------------------------
3cnvD           ----------------------------------------------------------------------
3cnvC           ----------------------------------------------------------------------
3ddvD           ----------------------------------------------------------------------
3bwgB           ----------YQQIATEIETYIEEHQLQQGDKLPV-LETLAQFEVSKSTITKSLELLEQKGAIFQVRGSG
2di3B           ---------AHESVMDWVTEELRSGRLKIGDHLPSERALSETLGVSRSSLREALRVLEALGTISTATGSG
2di3A           ---------AHESVMDWVTEELRSGRLKIGDHLPSERALSETLGVSRSSLREALRVLEALGTISTATGSG
3edpA           ---------LFEVIASKIKDSINRDEYKTG---PNETALQEIYSSSRTTIRRAVDLLVEEGLVVRKNGVG
3edpB           ---------LFEVIASKIKDSINRDEYKTG---PNETALQEIYSSSRTTIRRAVDLLVEEGLVVRKNGVG
3bwgA           -----------QQIATEIETYIEEHQLQQGDKLPV-LETLAQFEVSKSTITKSLELLEQKGAIFQVRGSG
3ddvA           ----------------------------------------------------------------------
3bwgC           ----------YQQIATEIETYIEEHQLQQGDKLPVL-ETLAQFEVSKSTITKSLELLEQKGAIFQVRGSG
1e2xA           ---------PAGFAEEYIIESIWNNRFPPGTILPAERELSELIGVTRTTLREVLQRLARDGWLTIQHGKP
3ddvC           ----------------------------------------------------------------------
3by6E           --AITQKRPVYLQLVDRIKNEVATDVLSANDQLPSVRETALQEKINPNTVAKAYKELEAQKVIRTIPGKG
3by6B           --AITQKRPVYLQLVDRIKNEVATDVLSANDQLPSVRETALQEKINPNTVAKAYKELEAQKVIRTIPGKG
3by6D           --AITQKRPVYLQLVDRIKNEVATDVLSANDQLPSVRETALQEKINPNTVAKAYKELEAQKVIRTIPGKG
3by6A           --AITQKRPVYLQLVDRIKNEVATDVLSANDQLPSVRETALQEKINPNTVAKAYKELEAQKVIRTIPGKG
3by6C           --AITQKRPVYLQLVDRIKNEVATDVLSANDQLPSVRETALQEKINPNTVAKAYKELEAQKVIRTIPGKG
2b7oA           ---ESVPPVTVPSEIVRLQEQLAQVAKGEAFLLQ-GGDCAETFDNTEPHIRGNVRALLQAVVLTYGASPV
3c7jB           -NEQPPAHLARTVIEEKLRNAIIDGSLPSGTALR-QQELATLFGVSRP-VREALRQLEAQSLLRVETHKG
3c7jA           -NEQPPAHLARTVIEEKLRNAIIDGSLPSGTALR-QQELATLFGVSR-PVREALRQLEAQSLLRVETHKG
2b7oB           ---ESVPPVTVPSEIVRLQEQLAQVAKGEAF-LLQGGDCAETFDNTEPHIRGNVRALLQAVVLTYGASPV
1aoyA           ---------KQEELVKAFKALLKEEKFSSQGEIVAALQEQGFDNINQSKVSRMLTKFGAVRTRNAKMEMV
2ek5A           ---------LYKQIASLIEDSIVDGTLSIDQRVPSTNELAAFHRINPATARNGLTLLVEAGILYKKRGIG
2du9A           ---------LYKQIASLIEDSIVDGTLSIDQRVPSTNELAAFHRINPATARNGLTLLVEAGILYKKRGIG
2ek5B           ----------------LIEDSIVDGTLSIDQRVPSTNELAAFHRINPATARNGLTLLVEAGILYKKRGIG
3d0sB           IFTDVPGRVAKQLLQLAQRFGTQEGGALRVTHDLTQEEIAQLVGASRETVNKALADFAHRGWIRLEGKSV
2ek5C           ---------LYKQIASLIEDSIVDGTLSIDQRVPSTNELAAFHRINPATARNGLTLLVEAGILYKKRGIG
3d0sA           IFTDVPGRVAKQLLQLAQRFGTQEGGALRVTHDLTQEEIAQLVGASRETVNKALADFAHRGWIRLEGKSV
2d45B           ------------TYEISSAEWEVNIIWKKYASANNIIEEIQQKDWSPKTIRTLITRLYKKGFIDRKKDNK
2acjC           ------------HMEQRILKFL--EELGEGKATT-AHDLSGKLGTPKKEINRVLYSLAKKGKLQKEAGTP
2d45A           -------------------EWEVNIIWKKYASANNIIEEIQQKDWSPKTIRTLITRLYKKGFIDRKKDNK
1bibA           -------------------------LLANGEFH-SGEQLGETLGMSRAAINKHIQTLRDWGVDVFTVPGK
1c4kA           ---RQYFDTDRVVVDAVGSDFTDVGAVIAMDYETDVIDAADATKFGIPVFAVTKDAQAISADELKKIFHI
2co5A           -----------------LKVLVINGSRLEKKRLRSEILKRFDIDISDGVLYPLIDSLIDDKILREEEAPD
2dk8A           ------------EIENRIIELC-----HQFPHGITDQVIQNEPHIEAQQRAVAINRLLSMGQLDLLRSNT
2acjA           --------------------------EQRILKFTTAHDLSGKLGTPKKEINRVLYSLAKKGKLQKEAGTP
2acjD           -----------------QRILKFLEELGEGKAT-TAHDLSGKLGTPKKEINRVLYSLAKKGKLQKEAGTP
2b0lA           ---QMAISSLSYSELEAIEHIF--EELDGNEGLLVASKIADRVGITRSVIVNALRKLESAGVIESRSLGM
1b1bA           ----------LVDTTEMYLRTIY--DLEEEGVTPLRARIAERLDQSGPTVSQTVSRMERDGLLRVAGDRH
2d45D           -----------------SAEWEVNIIWKKYASANNIIEEIQQKDWSPKTIRTLITRLYKKGFIDRKKDNK
2acjB           ------------HMEQRILKFL--EELGEGKATT-AHDLSGKLGTPKKEINRVLYSLAKKGKLQKEAGTP
2b0lB           -----------SYSELEAIEHIFEELDGNEG-LLVASKIADRVGITRSVIVNALRKLESAGVIRSLGMKG
1bi0A           -------------------------ELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRS
1biaA           ---------KDNTVPLKLIAL-----LANGEFH-SGEQLGETLGMSRAAINKHIQTLRDWGVDVFTVPGK
1bi2B           -------------------------ELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRS
1bi3B           ----------------------------EEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRS
2dtrA           -------------------------ELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRS
1ddnA           -------------------------ELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRS
2e1nB           -----------------VLAVLRHEDSYGTELIQHLETHWPNYRLSDTVLYTALKFLEDEQIISGYWKKV
1c0wB           -------------------------ELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRS
1bi2A           ------------------------------GVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRS
1dprA           --------------------------LEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRS
3cuoD           -------------------------MLSGSPGT-SAGELTRITGLSASATSQHLARMRDEGLIDSQRDAQ
1dtr-           ------------------------------GVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRS
3cuoC           ----------------HPKRLLILCMLSGSPGT-SAGELTRITGLSASATSQHLARMRDEGLIDSQRDAQ
2co5B           -----------------------NGSRLEKKRLRSEILKRFDIDISDGVLYPLIDSLIDDKILREEEAPD
1c0wD           ----------------------------EEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRS
3cuoA           ----------------HPKRLLILCMLSGSPGT-SAGELTRITGLSASATSQHLARMRDEGLIDSQRDAQ
2dqlA           ----------------YILYVLLQGESYGTELIQQLETEHPTYRLSDTVLYSAIKFLEDNRAITGYWKKL


                         .         .         *         .         .         .         .:140
query           TFISPKVYKQQLLKFYSFTEEMKKLGKNPSSKILSFDLIRADNKISEKLKVEENSLVYKIVRLRIADEVP
3eetA           VRERPRVARSYRPSGATPFRQEQADGAVRGTWESHSEQAEASGAIAERLDIRPGERVCTKYVFR---DAG
3eetB           --VPRRVARSGYRSGATPFRQEQADGAVRGTWESHSEQAEASGAIAERLDIRPGERVCTKYV---FRDAG
3cnvB           ---------------YRFLRLAPDEEGEAESRILECRRLRAPAEIARALELRAGETVVTIRRQ--LSNHP
3cnvA           ------------------YRFLRLAPDEAESRILECRRLRAPAEIARALELRAGETVVTIRRQL--SNHP
3ddvB           -----------------------------SSRTVSYFVAKPSSSEMEKLQLGPEDSILRMERIRFADDIP
3cnvD           ----------------RYRFLRLAPDERAESRILECRRLRAPAEIARALELRAGETVVTIRRQL--SNHP
3cnvC           -------------RFLRLAPDEEGEGGRAESRILECRRLRAPAEIARALELRAGETVVTIRRQ--LSNHP
3ddvD           -----------------------------SSRTVSYFVAKPSSSEMEKLQLGPEDSILRMERIRFADDIP
3bwgB           IFVRK----HKRKGYISLLSNQDLEDFNVTSKVIEL-DVRKPTPEAAENLNIGDEDIYYVKRVRYINGQT
2di3B           PRSGTIITAAPGQALSLSVTLQLVTNQVGHHDIYETRQLLEGWAALHSSAERGDWDVAEALLEKMDDPSL
2di3A           PRSGTIITAAPGQALSLSVTLQLVTNQVGHHDIYETRQLLEGWAALHSSAERGDWDVAEALLEKMDDPSL
3edpA           LYVQPKLTAQNILETGVKNLKK----------DIKDFYIRKAGKFYAEIFGKENELVYSIKFVQKSEHGA
3edpB           LYVQPKLTAQNILETGVLKKDIKDFYIRKAGKFY------------AEIFGKENELVYSIKFVQKSEHGA
3bwgA           IFVRK-------HKRKGYISLLSNQGDFNVTSKVIELDVRKPTPEAAENLNIGDEDIYYVKRVRYINGQT
3ddvA           --------------------------RVPSSRTVSYFVAKPSSSEMEKLQLGPEDSILRMERIRFADDIP
3bwgC           IFVRKHKRK--------GYISLLSLEDFNVTSKVIELDVRKPTPEAAENLNIGDEDIYYVKRVRYINGQT
1e2xA           TKVNNFWETSGLNILETLARLDHESVPQLIDNLLSVRTNISTIFIRTAFRQHPDKAQEVLATANEVADHA
3ddvC           -------------------------NRVPSSRTVSYFVAKPSSSEMEKLQLGPEDSILRMERIRFADDIP
3by6E           TFITGNTASVKNSNQNRLLADLSQVIAELIKSGVKGERIKKIVNDILGGKNAE-----------------
3by6B           TFITGNTASVKNSNQNRLLADLSQVIAELIKSGVKGERIKK-----------------------------
3by6D           TFITGNTASVKNSNQNRLLADLSQVIAELIKSGVKGERIKK-----------------------------
3by6A           TFITGNTASVKNSNQNRLLADLSQV---------------------------------------------
3by6C           TFITGNTASVKNSNQNRLLADLSQVIAELIKSGVKGERIKK-----------------------------
2b7oA           VKVAR-----------------------------------------------------------------
3c7jB           AVVAPLITEDAV----------------------------------------------------------
3c7jA           AVVAPLITEDAV----------------------------------------------------------
2b7oB           VKVAR-----------------------------------------------------------------
1aoyA           YCLPAE----------------------------------------------------------------
2ek5A           FVSAQAPLIRERRDAAFAATYVAPLIDESIHLGFTRARIHALLDQVAESR--------------------
2du9A           FVSAQAPLIRERRDAAFAATYVAPLIDESIHLGFTRARIHALLDQVAESR--------------------
2ek5B           FVSAQAPLIRERRDAAFAATYVAPLIDESIHLGFTRARIHALLDQVAESR--------------------
3d0sB           LIS-------------------------------------------------------------------
2ek5C           FVSAQAP---------------------------------------------------------------
3d0sA           LISDS-----------------------------------------------------------------
2d45B           IFQY------------------------------------------------------------------
2acjC           PLWKI-----------------------------------------------------------------
2d45A           IFQY------------------------------------------------------------------
1bibA           GYSLPEPIQLLNAKQILGQLDGGSVAVLPVIDSTNQYLLDRIGELKSGDACIAEYQQAGRGRSPFGANLY
1c4kA           ID--------------------------------------------------------------------
2co5A           GKV-------------------------------------------------------------------
2dk8A           GLL-------------------------------------------------------------------
2acjA           PLWK------------------------------------------------------------------
2acjD           PLWK------------------------------------------------------------------
2b0lA           ----------------------------------------------------------------------
1b1bA           LELTE-----------------------------------------------------------------
2d45D           IF--------------------------------------------------------------------
2acjB           ----------------------------------------------------------------------
2b0lB           TYIKV-LNNKFLIELENL----------------------------------------------------
1bi0A           LQMTP-----------------------------------------------------------------
1biaA           GY--------------------------------------------------------------------
1bi2B           LQMTP-----------------------------------------------------------------
1bi3B           LQMTP-----------------------------------------------------------------
2dtrA           LQMTP-----------------------------------------------------------------
1ddnA           LQMTP-----------------------------------------------------------------
2e1nB           EGRGRPR------RMYQLAQANDDR---------------------------------------------
1c0wB           LQMTP-----------------------------------------------------------------
1bi2A           LQ--------------------------------------------------------------------
1dprA           LQMTP-----------------------------------------------------------------
3cuoD           RI--------------------------------------------------------------------
1dtr-           LQMTP-----------------------------------------------------------------
3cuoC           RI--------------------------------------------------------------------
2co5B           GKV-------------------------------------------------------------------
1c0wD           LQMTP-----------------------------------------------------------------
3cuoA           RI--------------------------------------------------------------------
2dqlA           EGRGRPR------RMYQVSPEWQHQ---------------------------------------------


                         +         .         .         .         .         *         .:210
query           MMVECTYLPEYRFIDLKEKMLKEKPMYDIFREVYNVSLTKAKESFKPILISKSDSKLLNVEDGTAAMRIE
3eetA           EVLSTSWEPLAVTGRT-PVLPEEGPVGGVERAAIDVIVDNVTEEVGARPGLAEELLTLGGVPGHVVLVIQ
3eetB           EVLSTSWEPLAVTGRT-PVLPEEGPVGGVERAAIDVIVDNVTEEVGARPGLAEELLTLGGVPGHVVLVIQ
3cnvB           TVIDDLWLPGTHFRGLTLELLTAAPLYGLFES-EFGVSVRADEKLRAVAASPEIAPLLGVEPGRPLLQVD
3cnvA           TVIDDLWLPGTHFRGLTLELLTAAPLYGLFES-EFGVSVRADEKLRAVAASPEIAPLLGVEPGRPLLQVD
3ddvB           ICFEVASIPYSLVSQYGKSEI-TNSFYKTLEAKSGHKIGHSNQTISAVQASEQIAEYLEIKRGDAILRVR
3cnvD           TVIDDLWLPGTHFRGLTLELLTAAPLYGLFES-EFGVSVRADEKLRAVAASPEIAPLLGVEPGRPLLQVD
3cnvC           TVIDDLWLPGTHFRGLTLELLTAAPLYGLFES-EFGVSVRADEKLRAVAASPEIAPLLGVEPGRPLLQVD
3ddvD           ICFEVASIPYSLVSQYGKSEI-TNSFYKTLEAKSGHKIGHSNQTISAVQASEQIAEYLEIKRGDAILRVR
3bwgB           LCYEESYYTKSIVTYLNNEIVSH-SIFHYIREGLGLKIGFSDLFLHVGQLNEEEAEYLGLEAGLPKLYIE
2di3B           PLEDFLRFDAEFHVVISK--GAENPLISTLMEALRLSVADHTVARARALPDWRATSARLQKEHRAILA--
2di3A           PLEDFLRFDAEFHVVISK-GAENPLISTLMEA-LRLSVADHTVARARALPDWRATSARLQKEHRA-----
3edpA           TLDRLILPLGLYPDLQAKDFQ-IINIIELVNSGKYKLFELEQE--LQLILAGNEQIKNHLNENDPVFKLS
3edpB           TLDRLILPLGLYPDLQAKDFQ-IINIIELVNSGKYKLFELEQE--LQLILAGNEQIKNHLNENDPVFKLS
3bwgA           LCYEESYYTKSIVTYLNNEIVSH-SIFHYIREGLGLKIGFSDLFLHVGQLNEEEAEYLGLEAGLPKLYIE
3ddvA           ICFEVASIPYSLV-----------------------KIGHSNQTISAVQASEQIAEYLEIKRGDAILRVR
3bwgC           LCYEESYYTKSIVTYLNNEI-VSHSIFHYIREGLGLKIGFSDLFLHVGQLNEEEAEYLGLEAGLPKLYIE
1e2xA           DAFAELDYNIFRGL--------------------------------------------------------
3ddvC           ICFEVASIPYSLVGH-------------------------SNQTISAVQASEQIAEYLEIKRGDAILRVR
3by6E           ----------------------------------------------------------------------
3by6B           ----------------------------------------------------------------------
3by6D           ----------------------------------------------------------------------
3by6A           ----------------------------------------------------------------------
3by6C           ----------------------------------------------------------------------
2b7oA           ----------------------------------------------------------------------
3c7jB           ----------------------------------------------------------------------
3c7jA           ----------------------------------------------------------------------
2b7oB           ----------------------------------------------------------------------
1aoyA           ----------------------------------------------------------------------
2ek5A           ----------------------------------------------------------------------
2du9A           ----------------------------------------------------------------------
2ek5B           ----------------------------------------------------------------------
3d0sB           ----------------------------------------------------------------------
2ek5C           ----------------------------------------------------------------------
3d0sA           ----------------------------------------------------------------------
2d45B           ----------------------------------------------------------------------
2acjC           ----------------------------------------------------------------------
2d45A           ----------------------------------------------------------------------
1bibA           LSM-------------------------------------------------------------------
1c4kA           ----------------------------------------------------------------------
2co5A           ----------------------------------------------------------------------
2dk8A           ----------------------------------------------------------------------
2acjA           ----------------------------------------------------------------------
2acjD           ----------------------------------------------------------------------
2b0lA           ----------------------------------------------------------------------
1b1bA           ----------------------------------------------------------------------
2d45D           ----------------------------------------------------------------------
2acjB           ----------------------------------------------------------------------
2b0lB           ----------------------------------------------------------------------
1bi0A           ----------------------------------------------------------------------
1biaA           ----------------------------------------------------------------------
1bi2B           ----------------------------------------------------------------------
1bi3B           ----------------------------------------------------------------------
2dtrA           ----------------------------------------------------------------------
1ddnA           ----------------------------------------------------------------------
2e1nB           ----------------------------------------------------------------------
1c0wB           ----------------------------------------------------------------------
1bi2A           ----------------------------------------------------------------------
1dprA           ----------------------------------------------------------------------
3cuoD           ----------------------------------------------------------------------
1dtr-           ----------------------------------------------------------------------
3cuoC           ----------------------------------------------------------------------
2co5B           ----------------------------------------------------------------------
1c0wD           ----------------------------------------------------------------------
3cuoA           ----------------------------------------------------------------------
2dqlA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           RVTFENERVIEYTVSVSRGDKFEYTVVLExx
3eetA           RTYFASGRPVETADVVVPADRYRVAYHL---
3eetB           RTYFASGRPVETADVVVPADRYRVAYHL---
3cnvB           RISYTYGDRPEVRRGLYLTDHYHYRNSL---
3cnvA           RISYTYGDRPEVRRGLYLTDHYHYRNSL---
3ddvB           QVSYENGLPFEYVRTQYAGSRFEFYL-----
3cnvD           RISYTYGDRPEVRRGLYLTDHYHYRNSL---
3cnvC           RISYTYGDRPEVRRGLYLTDHYHYRNSL---
3ddvD           QVSYENGLPFEYVRTQYAGSRFEFYL-----
3bwgB           SIFHTNGQPFDYSKISYNYEQSQFVV-----
2di3B           -------------------------------
2di3A           -------------------------------
3edpA           SVFYAENDPIAIQYHYEDAESTKYVV-----
3edpB           SVFYAENDPIAIQYHYEDAESTKYVVDFN--
3bwgA           SIFHTNGQPFDYSKISYNYEQSQFVVQA---
3ddvA           QVSYENGLPFEYVRTQYAGSRFEFYL-----
3bwgC           SIFHTNGQPFDYSKISYNYEQSQFVVQA---
1e2xA           -------------------------------
3ddvC           QVSYENGLPFEYVRTQYAGSRFEFYLE----
3by6E           -------------------------------
3by6B           -------------------------------
3by6D           -------------------------------
3by6A           -------------------------------
3by6C           -------------------------------
2b7oA           -------------------------------
3c7jB           -------------------------------
3c7jA           -------------------------------
2b7oB           -------------------------------
1aoyA           -------------------------------
2ek5A           -------------------------------
2du9A           -------------------------------
2ek5B           -------------------------------
3d0sB           -------------------------------
2ek5C           -------------------------------
3d0sA           -------------------------------
2d45B           -------------------------------
2acjC           -------------------------------
2d45A           -------------------------------
1bibA           -------------------------------
1c4kA           -------------------------------
2co5A           -------------------------------
2dk8A           -------------------------------
2acjA           -------------------------------
2acjD           -------------------------------
2b0lA           -------------------------------
1b1bA           -------------------------------
2d45D           -------------------------------
2acjB           -------------------------------
2b0lB           -------------------------------
1bi0A           -------------------------------
1biaA           -------------------------------
1bi2B           -------------------------------
1bi3B           -------------------------------
2dtrA           -------------------------------
1ddnA           -------------------------------
2e1nB           -------------------------------
1c0wB           -------------------------------
1bi2A           -------------------------------
1dprA           -------------------------------
3cuoD           -------------------------------
1dtr-           -------------------------------
3cuoC           -------------------------------
2co5B           -------------------------------
1c0wD           -------------------------------
3cuoA           -------------------------------
2dqlA           -------------------------------