[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for cper0:BAB80017.1

[Show Plain Result]


## Summary of Sequence Search
    1::262
   12::150     6e-17  37%  157 aa  PF01012 ETF "Electron transfer flavoprotein domain"
    1::262

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxMNPYDLYALETALRIKEKKGGNIKVISMGPPQAKAVI
PF01012         ---------------------------------LNPVDLEALEEARRLAEKLGGEVTAVVAGPAEA-AEA


                         .         .         *         .         .         .         .:140
query           KEAYSMGADEGTLVSDRKFAGADVLATSYTLSQGVKKCGDFDIILCGKQTTDGDTAQVGPEMAEYLGIPH
PF01012         RTALAMGADRVVLVEDPALAGYDPEAYAKALAALIKK-EKPDLVLLGATAIGRD---LGPRLAARLGVPQ


                         +         .         .         .         .         *         .:210
query           VANVRRILDVNDDFIKVEMDMPNTIEVLEVKYPCLLTVxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01012         ATDVTK-LEIDDGKLTVTRPIYGGNETATVKLPAVITV--------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01012         ----------------------------------------------------