[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for cper0:BAB80033.1

[Show Plain Result]


## Summary of Sequence Search
    1::171
    1::127     1e-31  49%  140 aa  PF02502 LacAB_rpiB "Ribose/Galactose Isomerase"
    1::171

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xKIAIGCDHIVTDTKIAVSDFLKAKGYDVLDVGTYDFTRTHYPIFGKKVGEAVASGEADLGVCICGTGVG
PF02502         -KIAIGSDHAGFELKEAIKEHLKEKGHEVVDVGTYSEESVDYPDYAIAVAEAVASGEADRGILICGTGIG


                         .         .         *         .         .         .         .:140
query           INNAVNKVPGIRSALVRDMTTAIYAKEQLNANVIGFGGKITGEFLMCDIIEAFIKADYxxxxxxxxxxxx
PF02502         MSIAANKVPGIRAALCHDPYSARLAREHNNANVLALGARVIGPELAKKIVDAFLNTEF------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02502         -------------------------------