[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for cper0:BAB80140.1

[Show Plain Result]


## Summary of Sequence Search
    1::162
    4::79      4e-05  34%   80 aa  PF00583 Acetyltransf_1 "Acetyltransferase (GNAT) family"
    1::162

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00583         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxNGERIGTIMIVPSLSEEEGVQEIKYLALLPKYQEQGLGKLLISKAYKMVDDVEGATR
PF00583         -------------DGEIVGFARLRPP-GDDGPVAYIAGLAVLPEYRGKGIGRALLEALLEYAREL-GVRR


                         +         .         .         .         .         *         .:210
query           INLEAYNDKSIVLFENLGFxxx
PF00583         IVLEVGNEAAIRFYEKLGF---