[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for cper0:BAB80292.1

[Show Plain Result]


## Summary of Sequence Search
    1::248
    1::150     3e-30  47%  157 aa  PF00455 DeoR "Bacterial regulatory proteins, deoR family"
    1::51      3e-06  47%   56 aa  PF08220 HTH_DeoR "DeoR-like helix-turn-helix domain"
    1::248

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxRHEIILNLLKLKGFVXXXXXXXXXXXXXXXIRRDLSYLESINLLKRVHGGAxxxxxxxxxxxxxx
PF00455         ----------------------------------------------------------------------
PF08220         -----RQQKILELLKEQGKVSVKELAELLGVSEATIRRDLNELEEQGLLKRVHGGA--------------


                         .         .         *         .         .         .         .:140
query           xxxxxIHEKRAIAKYAASLIEDGDCIFVDAGTTTYELIDYLEGKDILVVSNGLSHIDTLIQKNIKCYVIG
PF00455         -----IEEKRAIAKAAASLIPDGDTIFLDAGTTTLALARALDHKNLTVVTNSLNIANALSENNIEVILLG
PF08220         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           GNIKISTKAITGCDALMCLSKFRFDKCFIGANGVHHTYGLTTPDTEEAILKECAINNSRKAYVLADDSKF
PF00455         GEVRPKSGSFVGPLAEEFLRQFRFDKAFIGADGIDLDGGLTTFDEEEAAVKRAMIENARKVILLADSSKF
PF08220         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           GEISTIKFSDINKxxxxxxxxxxxxxxxxxxxxxxxxx
PF00455         GRVAFAKIAPLSE-------------------------
PF08220         --------------------------------------