[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for cper0:BAB80503.1

[Show Plain Result]


## Summary of Sequence Search
    1::193
   20::123     7e-08  42%  132 aa  PF01569 PAP2 "PAP2 superfamily"
    1::193

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01569         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           ILAVIVGHFFYAPRPFVNDPNAKLLYPHKPDSSFPSGHSVGSMSIALGLNRYNKALGTICVILSILMGIS
PF01569         LLKLLVGR----PRPFFLDRCGPLDTPGTPDGSFPSGHSALAFAFALFLSLHLLLLALLLLLLALLVAIS


                         +         .         .         .         .         *         .:210
query           RVYVGHHYPQHVVASFLIVIILNVLxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01569         RVYLGVHYPSDVLAGALLGLLVALL----------------------------