[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for cper0:BAB80734.1

[Show Plain Result]


## Summary of Sequence Search
    1::113
    3::97      6e-11  32%  101 aa  PF02641 DUF190 "Uncharacterized ACR, COG1993"
    1::113

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxGSFLKIFIDESDKYNGEPLYLEILKVLKKENILGATVIRGIEGLDSHHKIHSDFIEILARNLPX
PF02641         ------GKLLRIYTGENDRHGGKPLYEWIVELAKEMGIAGATVLRGIEGFGHHGRLHSARFFELSDDLPV


                         .         .         *         .         .         .         .:140
query           XXXXXXXXXXXXXXXXXXXPMIETGTITVIDxxxxxxxxxxxx
PF02641         VIEIVDTEEKIEAFLPKLEELVKDGLVTLED------------