[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for cper0:BAB81009.1

[Show Plain Result]


## Summary of Sequence Search
    1::397
    1::383     e-127  66%  383 aa  PF00162 PGK "Phosphoglycerate kinase"
    1::397

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxTIEDVQVKGKKVLVRCDFNVPLKDGVITDENRLNGAMPTIKYLVDNGAKVILCSHMGKPKGEAK
PF00162         ------SIDDLDLKGKRVLVRVDFNVPLKDGKITDDTRIRAALPTIKYLLEQGAKVILMSHLGRPKGEYK


                         .         .         *         .         .         .         .:140
query           PEFSLAPVAKRLSEMLGKEVVFAADDNVVGENAKKAVAEMKDGDVVLLQNTRYRKEETKNGXXXXXXXXX
PF00162         EKYSLKPVAERLSELLGKPVKFA--DDCVGPEVEAAVAALKPGEVLLLENVRFYKEEEKNDEAFAKKLAS


                         +         .         .         .         .         *         .:210
query           XXXMFVNDAFGTAHRAHCSTVGVTEYLKPAVCGYLIQKELKFLGDAVETPERPFVAILGGAKVSDKINVI
PF00162         LGDVYVNDAFGTAHRAHASTVGIAKFLPPAAAGFLMEKELEALGKALENPERPFVAIVGGAKVSDKIGVI


                         .         .         .         +         .         .         .:280
query           NNLLEKVDTLIIGGGMAYTFLKAQGYTVGSSLVEEDKVEYAKEMLAKAEEKGVKLLLPVDHRVAKEFKDV
PF00162         ENLLDKVDKLIIGGGMANTFLKAQGYEIGKSLVEEDKVELAKELLEKAKARGVKILLPVDVVVADEFSDA


                         .         *         .         .         .         .         +:350
query           EAVVTEDQNIAEGFMGLDIGPKTEAIYAEAIKDAKTVIWNGPMGVFEFENFNKGTIAVAKAMAEADATTI
PF00162         EAKVVEVDAIPDGWMGLDIGPKTIELFAEAIKNAKTIVWNGPMGVFEFDPFAKGTKAVAKAIAESGAFSI


                         .         .         .         .         *         .         .:420
query           IGGGDSAAAVNILGFGDKMSHISTGGGASLEFLEGKxxxxxxxxxxx
PF00162         IGGGDTAAAVEKLGLADKFSHISTGGGASLELLEGK-----------