[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for cper0:BAB81021.1

[Show Plain Result]


## Summary of Sequence Search
    1::301
    1::199     6e-40  43%  199 aa  PF07478 Dala_Dala_lig_C "D-ala D-ala ligase C-terminus"
    1::107     6e-16  51%  108 aa  PF01820 Dala_Dala_lig_N "D-ala D-ala ligase N-terminus"
    3::169     5e-13  34%  177 aa  PF08443 RimK "RimK-like ATP-grasp domain"
    1::158     3e-11  29%  164 aa  PF02655 ATP-grasp_3 "ATP-grasp domain"
    1::88      1e-08  35%  207 aa  PF02786 CPSase_L_D2 "Carbamoyl-phosphate synthase L chain, ATP
    1::301

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKVGVIMGGISSEREISIQSGNSVVHALDKDKYEAIPIVLNEKEDLIEKVKGIDFALLALHGKFGEDGTV
PF07478         ----------------------------------------------------------------------
PF01820         LKVAVLFGGRSSEREVSLVSATNVLAALDKDGYDVIPIDITKDGDLLPSVEEVDVVFPALHGGYGEDGTL
PF08443         ----------------------------------------------------------------------
PF02655         ----------------------------------------------------------------------
PF02786         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           QSVLKTLGIPFSGxxxxxxxxxMDKDMTKRILAFGNVRTARWEMVSSVDEIDYEKIENLGYPVFVKPNNG
PF07478         ------------------------------LLRAAGIPTAPYVVLTRGEDLDADEVEELGYPVFVKPARG
PF01820         QGLLELLGIPYTG---------------------------------------------------------
PF08443         -----------------------DKLRTLQLLARAGIPVPKTGVANSPEDA-LDLIEELGFPVVIKPLDG
PF02655         ----------------------LDKYRTRELLAEAGIPVPETYAAAEAEEI--------GYPVVVKPRDG
PF02786         -----------------------DKDRFKELMKKAGVPVPPGSIATSVEEA-LEAAEEIGYPVIVKPSYG


                         +         .         .         .         .         *         .:210
query           GSSVATTLVESKEAVKDAVLEALKYDTEVMIEEYIKGDEITCPIIDGKMLPVLAIKPKGKFFDIASKYGD
PF07478         GSSVGVSKVKNEEELEAALEEAFQYDSKVLVEEFIKGREITVAVLEPKALPPGEIVPDGGFYDYEAKYID
PF01820         ----------------------------------------------------------------------
PF08443         SQGRGVVLAETREEL-ESVLEAFRLSAPILVQEFIAGRDIRVFVVGGKV--VAAMKRQSAEGDWRSNLHR
PF02655         AGSLGVRLVDNEEELEEALEELLEASEPVLVQEFIEGPEYSVEVLDGGEALVLGVSRQRIGREPTFVYTG
PF02786         GGGRGMRIVYNEEELEEALREALAENDPVLIEKFLEG---------------------------------


                         .         .         .         +         .         .         .:280
query           GGADEFIVELNEDLHKEVEKMALETYKLLKCDVYARVDMLVKDNIPYVLEVNTLPGMTKNSLFPKSAAGI
PF07478         GGTTYIIADLPEEVEEKIRELALKAFRALGCRGLARVDFLDEDGEPYLLEVNTLPGMTPTSLYPKAAEAA
PF01820         ----------------------------------------------------------------------
PF08443         GGKAEPV-----ELTPEERELALKAAKALGLGV-AGVDLLRSNDGPLVLEVNSSPGL-------------
PF02655         ASVPARLPEREELI--ELAERALEALGLRG---PVGVDFILTDGGPYLIEIN------------------
PF02786         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           NMSFEELLDTIIExxxxxxxx
PF07478         GISYSELIERLIE--------
PF01820         ---------------------
PF08443         ---------------------
PF02655         ---------------------
PF02786         ---------------------