[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for cper0:BAB81084.1

[Show Plain Result]


## Summary of Sequence Search
    1::303
    1::221     2e-19  37%  241 aa  PF04018 DUF368 "Domain of unknown function (DUF368)"
    1::303

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxMALADSVPGVSGGTIAFIMGFYNKFISSLNALXXXXXXXXXXXXAIIFLLKLGIGWITG
PF04018         -----------MGAADVVPGVSGGTIAFILGIYERLIESISGFNLSALKKLLRNG--LFLLPLGIGILTG


                         .         .         *         .         .         .         .:140
query           MVLSILFIASIFDKEIYKISSLFTGXXXXXXXXXXXEDKESLKKNXXXXXXXXXXXXXXXXXTYFNPATG
PF04018         ILLFSKVITYLLENYPVPTWSFFFGLILGSIPLLLKEVKKFTPKHILAFILGLALAVGI---TFLSPAAG


                         +         .         .         .         .         *         .:210
query           SAKGTSLVLNEFSLPLALYVFFAGMIAISAMVLPGISGSTLLLIFGLYAPVVNGVKEVLTFNFSYXXXXX
PF04018         T-----------STPTLLLLFLAGAIAACAMILPGISGSFILLLLGLYTPVLGAIKSL------DLPILI


                         .         .         .         +         .         .         .:280
query           XXXXXXXXXXXXXXXXXKFLLSNYRSQMIYFIIGLMIGSIYAVFxxxxxxxxxxxxxxxxxxxxxxxxxx
PF04018         PFAIGVVIGLVVFSKLISYLLKRYRSLTYAFIIGLVIGSLYAVW--------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxx
PF04018         -----------------------