[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for cper0:BAB81104.1

[Show Plain Result]


## Summary of Sequence Search
    1::235
    4::210     1e-20  35%  229 aa  PF01048 PNP_UDP_1 "Phosphorylase superfamily"
    1::235

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxLLPGDPLRAKFIAETFLENPVCYNEVRGMLGYTGTYKGKRISVQGTGMGVPSIS
PF01048         ----------------IICGLPLEAAALAELPLEDIPYGPPGDGNTYTTGTIGGHNVVVASTGIGKVSAA


                         .         .         *         .         .         .         .:140
query           IYVNELIRDYGVKNLIRVGTAGGMQEDIKVRDLVLAMSSHTDSAINKVRFNGLDFAPTASFKLLKAAYDT
PF01048         IAATRLLKSFGVRLIIRVGICGGLNPDIRLGDVVVSTDPLTGPNEGGVRFPDLSDA-KADPELRAAAEEA


                         +         .         .         .         .         *         .:210
query           AVEKGYSPKVGSVFTADSFYNDNPEAWKQWAKFGTLAVEMETAALYTLAAKYGVNALTILTISDHLITAE
PF01048         AKELGPRVHYGTIASGDGFYKSTRARDRLARKLGALAVEMEAAGLAAVARENGVPCLVIRGISDYADSGK


                         .         .         .         +         .         .         .:280
query           ETTSEExxxxxxxxxxxxxxxxxxx
PF01048         DDEAEE-------------------