[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for cper0:BAB81143.1

[Show Plain Result]


## Summary of Sequence Search
    1::400
    1::150     1e-20  37%  152 aa  PF05201 GlutR_N "Glutamyl-tRNAGlu reductase, N-terminal domain"
    6::98      2e-04  31%  101 aa  PF00745 GlutR_dimer "Glutamyl-tRNAGlu reductase, dimerisation
    1::400

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxIGVKRNVDIAIREKLALYPKKHKKYVGELLNSFKEVVILNTCNRTEIYFNCTEEISEDEIFDKIFN
PF05201         ----IGINKTAPVELREKLAFSPEELKEALKQLIPGILEAVILSTCNRTEIYAVVDDHAAREELIRWLAD
PF00745         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           VFNWNDDLKKYMFLSKEKRAVTHLMEVICGFHSRILGEDQILGQIKDAYKTAISDNSISSELQKMFEIAI
PF05201         FHGLDDELRPYLYVYEGDEAVRHLFRVASGLDSMVLGEPQILGQVKDAYRLAQEAGTLGPILNRLFQRAF
PF00745         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           ACGKKFKTExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF05201         AVAKRVRTE-------------------------------------------------------------
PF00745         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF05201         ----------------------------------------------------------------------
PF00745         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxIVEESIEEFLNWLKIREVSSKIRNIKIRENEICSERIKTFSNK
PF05201         ----------------------------------------------------------------------
PF00745         ---------------------------IIEEEVEEFMEWLKSLEVVPTIRALRSKAEEIREEELKALKKL


                         .         .         .         .         *         .         .:420
query           GNGENAKLAERMIKSTADAYVNRAIELLKSEALKGSDSSCAEIIEKIFxx
PF05201         --------------------------------------------------
PF00745         ALGEDRKVLEKLSRSLTNKLLHAPTKALKEAAAEGDADEYLEALRRLF--