[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for cper0:BAB81144.1

[Show Plain Result]


## Summary of Sequence Search
    1::326
    6::60      6e-11  40%   67 aa  PF03460 NIR_SIR_ferr "Nitrite/Sulfite reductase ferredoxin-like
    6::71      1e-08  46%  153 aa  PF01077 NIR_SIR "Nitrite and sulphite reductase 4Fe-4S domain"
    1::22      2e-04  64%   24 aa  PF00037 Fer4 "4Fe-4S binding domain"
    1::326

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxGYTASRIRVPGGHLDAKLLLNIQEIADTYGDGTVHITTRQGFEIPGIDM
PF03460         ---------------------GFHTVRVRIPGGRLTTEQLRALADIADKYGSGELRLTTRQNIQLLGVKK
PF01077         ----------------------------------------------------------------------
PF00037         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           KDIPEVxxxxxxxxxxxxxxxxxxxxxxxxxxxRNVSACIGNNVCPFANYNTTNFAKKIEKAIFPNDLHF
PF03460         EDLPEL----------------------------------------------------------------
PF01077         ---------------------------------RNPVACPGAGRCEYACYDTQGLAYALTDEL-QDELHF
PF00037         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           KIALTGCPNDCIKARMHDFGIIGxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxVVRDGSKCIGCG
PF03460         ----------------------------------------------------------------------
PF01077         KIKFSGCPNDCVAAIARDIGIIG-----------------------------------------------
PF00037         ----------------------------------------------------------LVIDEDKCIGCG


                         .         .         .         +         .         .         .:280
query           ECVMNCPTNAxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF03460         ----------------------------------------------------------------------
PF01077         ----------------------------------------------------------------------
PF00037         ACVEACPTGA------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF03460         ----------------------------------------------
PF01077         ----------------------------------------------
PF00037         ----------------------------------------------