[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for cper0:BAB81145.1

[Show Plain Result]


## Summary of Sequence Search
    1::263
    1::103     1e-09  32%  107 aa  PF00175 NAD_binding_1 "Oxidoreductase NAD-binding domain "
    1::33      4e-06  59%   38 aa  PF10418 DHODB_Fe-S_bind "Iron-sulfur cluster binding domain of
    2::96      4e-05  35%   99 aa  PF00970 FAD_binding_6 "Oxidoreductase FAD-binding domain"
    1::263

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxSKILNVKKHTDIEYTFRMEFKGDVKPGQFFEVSLPKFGEAPISVSGIGEDYVELTIRRVGV
PF00175         ----------------------------------------------------------------------
PF10418         ----------------------------------------------------------------------
PF00970         ---------TKVVSVEPETPDVKSFRLRLPDGFKPGQYVMVRLPIDGERPYSPASSPDEELELLVKRVGK


                         .         .         *         .         .         .         .:140
query           VTNEIFEKYEGDKLFLRGPYGNxxxxxxxxxxxxxVVAGGTGLSPVKGIVDYFSQNPKDAESFTLISGFK
PF00175         -----------------------------------LIAGGTGIAPFRSMLRELLAR-EDGGKVTLFYGAR
PF10418         ----------------------------------------------------------------------
PF00970         VSNYLHNLKPGDTVEVRGPLGD------------------------------------------------


                         +         .         .         .         .         *         .:210
query           GPKDILFKDDMKEWEKNMNMIITVDSAEEGYEGNTGLVTKYIPELEIKDMDNVQVIVVGPPMMMKxxxxx
PF00175         TEEDLLYREELEELHPNRLKVVYVSRPEDGWDGRKG----YVQDLLLEDLEDAHVYVCGPPPMMK-----
PF10418         ----------------------------------------------------------------------
PF00970         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxERKMCCGLGKCGHCKIDDTYICLDGPVFNxxxxxxxxx
PF00175         -----------------------------------------------------
PF10418         ---------------ERRMACGIGACGACKVKGGYVCVDGPVFD---------
PF00970         -----------------------------------------------------