[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for cper0:BAB81193.1

[Show Plain Result]


## Summary of Sequence Search
    1::334
   29::216     2e-13  31%  253 aa  PF02621 DUF178 "Putative periplasminc binding protein (DUF178)"
    6::197     3e-11  27%  200 aa  PF09084 NMT1 "NMT1/THI5 like"
    1::334

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxKGLDI
PF02621         ----------------------------------------------------------------------
PF09084         -----------------------------------------------------------------EGLDV


                         .         .         *         .         .         .         .:140
query           NYSIVKGSDALVSKVLKGEGDICIVPSNVAAIAYNKEAKYKLAGTVGFGSLYVISSDDSVNSLEDLKGKD
PF02621         ---VLADPETLNEALLKGELDVAAISS----AAYARLAKYALLPDLSIGALGRVYSPLLVSKLEELKGKR
PF09084         ELVEFAGGAAVLEALASGKADFAVAPPVLAARAKGAPVKAVAALYQSEGQALVVRKDSGIKSLADLKGKR


                         +         .         .         .         .         *         .:210
query           VYNVGQGLTPDLIFKILLQNDGINPEKDLTLSYVNAASELAPLFIEGKAKYAVVPEPMLTQIMTKKPETK
PF02621         VALPGESTTSVLLLRLLLPKAGLDPR----IVYV-PFDEIEPAVLSGEDAGLLIGEEALTY---PREGLK
PF09084         I-GVPGGSSTEYLLRALLAKAGLDPD-DVTLVNLGPADAAAAL-LSGQVDAAAWFPPW-------EPVEA


                         .         .         .         +         .         .         .:280
query           IVASLNEQWKEMSDSKMGYPQSSVIVKEDLAKNNSEAVQKILKEIDNSTKWANENKEEAGAFAEExxxxx
PF02621         VVLDLGEEWEELTG--LPFPLGVIAVRRDLPEEDAEELEEALRE---SVEYALAHPEELAEYAAE-----
PF09084         EAEGVDLRVLLLADLGVNFPGDVLVAREDFLEENPELVKAFLKALLKAADWAAAN---------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02621         ------------------------------------------------------
PF09084         ------------------------------------------------------