[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for cper0:BAB81210.1

[Show Plain Result]


## Summary of Sequence Search
    1::337
    2::69      3e-18  72%   70 aa  PF06725 3D "3D domain"
   12::59      3e-05  46%   78 aa  PF07501 G5 "G5 domain"
    1::337

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF06725         ----------------------------------------------------------------------
PF07501         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF06725         ----------------------------------------------------------------------
PF07501         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxIEFTTEVKKDESKPQTYTEVLNDGQDGEKKVTRELVYENGKEVSNNVIxx
PF06725         ----------------------------------------------------------------------
PF07501         --------------------IPFETKVEEDPSLPKGEEKVVQEGKKGEKTITYRVVYVNGKEVSRELI--


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxTIAV
PF06725         ------------------------------------------------------------------SIAV
PF07501         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           DPSVIPLGTKLYVEGYGYAIAADTGGAIKGNRVDLFFNTEAEASNWGVRNLDVYILx
PF06725         DPSVIPLGSKVYIEGYGLAIAQDTGGAIKGNRIDLFFGTEAGALAWGRKTGRVYVL-
PF07501         ---------------------------------------------------------