[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for cper0:BAB81382.1

[Show Plain Result]


## Summary of Sequence Search
    1::796
   16::185     2e-65  67%  186 aa  PF01580 FtsK_SpoIIIE "FtsK/SpoIIIE family"
    1::67      2e-20  63%   67 aa  PF09397 Ftsk_gamma "Ftsk gamma domain"
  638::748     3e-05  28% 1179 aa  PF12128 DUF3584 "Protein of unknown function (DUF3584)"
   29::151     8e-04  32%  268 aa  PF08764 Coagulase "Staphylococcus aureus coagulase"
    1::796

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01580         ----------------------------------------------------------------------
PF09397         ----------------------------------------------------------------------
PF12128         ----------------------------------------------------------------------
PF08764         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01580         ----------------------------------------------------------------------
PF09397         ----------------------------------------------------------------------
PF12128         ----------------------------------------------------------------------
PF08764         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxFDYNLVSIRNFFGGFKEKASKVKFVDKKYEKDDYINL
PF01580         ----------------------------------------------------------------------
PF09397         ----------------------------------------------------------------------
PF12128         ----------------------------------------------------------DLKRLKNELEEL
PF08764         ---------------------------------FIYALDLLNNYYGEPEYKEAKDKLMTRILGEDQYLLE


                         .         .         .         +         .         .         .:280
query           KKKDGASEGNKESKKDDISEDNNKIKILDFMKNSSLNDIEDNKKEKDNQLKDNIKINDFKQESKMPRDLS
PF01580         ----------------------------------------------------------------------
PF09397         ----------------------------------------------------------------------
PF12128         KKK---AEEAKEERKQELEEQLNALEAELKQLKEELEELLEEQKEQLNELRNEKKAQWQELEGELDNQLE
PF08764         KKKDEYEKYKKWYKKYK-KEPNTKLKMAKFDK----YNLYGLTMEEYNYIFNSLKVEEFKKEVK-----K


                         .         *         .         .         .         .         +:350
query           LDNTIIEQRGFNSEKAKEEESIDKEISNNIASKGxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01580         ----------------------------------------------------------------------
PF09397         ----------------------------------------------------------------------
PF12128         QIKAEIEA---ERQEAKERKELEQAYKNELASKG------------------------------------
PF08764         IQSKNPDLKPFNEE---EEDKATKEI--------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01580         ----------------------------------------------------------------------
PF09397         ----------------------------------------------------------------------
PF12128         ----------------------------------------------------------------------
PF08764         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLGKDITGKAVVTDLSKMPHVLIAGATGSGKSVCINTLIV
PF01580         -------------------------------LGKDISGEPVVLDLAKMPHLLIAGATGSGKSVLLNTLIL
PF09397         ----------------------------------------------------------------------
PF12128         ----------------------------------------------------------------------
PF08764         ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           SILYKYSPDEVKLLMIDPKVVELNVYNGIPHLLIPVVTDPKKAAAALNWAVNEMTRRYKLFADNGVRNIE
PF01580         SLLYKATPEEVRLYLIDPKGGELSVYEGLPHLLAPVVTDPEKAARALRWLVAEMERRYELFSEAGVRNIA
PF09397         ----------------------------------------------------------------------
PF12128         ----------------------------------------------------------------------
PF08764         ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           SYNALYNKGEVPEKLPYIVIIVDELADLMMACPHDVEDYICRLAQMARAAGMHLVIATQRPSxxxxxxxx
PF01580         GYNKKVAEAEL-EPLPYIVVVIDEFADLMMVAPKDVEELIARLAQKARAAGIHLILATQRPS--------
PF09397         ----------------------------------------------------------------------
PF12128         ----------------------------------------------------------------------
PF08764         ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01580         ----------------------------------------------------------------------
PF09397         ----------------------------------------------------------------------
PF12128         ----------------------------------------------------------------------
PF08764         ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           xxxxxxxxxxxxxxxxxxxxxxNGDGDRDELLDEAIEIVVESGQASASYLQRRLRIGFNRAARIIEELEE
PF01580         ----------------------------------------------------------------------
PF09397         ----------------------NGE-EEDPLYDEAVEFVVESGKASISLLQRRLRIGYNRAARLIDQLEE
PF12128         ----------------------------------------------------------------------
PF08764         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           CGVISRRDGSKPRQVLLSKDxxxxxx
PF01580         --------------------------
PF09397         NGIVSPAEGSKPREVLVPEE------
PF12128         --------------------------
PF08764         --------------------------