[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for cper0:BAB81490.1

[Show Plain Result]


## Summary of Sequence Search
    1::142
    1::125     1e-36  55%  126 aa  PF01592 NifU_N "NifU-like N terminal domain"
    1::142

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xIYSEKVMDHFKNPRNVGEIKDANGIGEVGNAKCGDIMRIYLKIENNIVEDVKFETYGCGSAIASSSMAT
PF01592         -LYSEKILDHYKNPRNVGELDDADGTGHVGNPTCGDEITLQLKVDDDIIEDAKFDGFGCAISQASASMMT


                         .         .         *         .         .         .         .:140
query           ELIKGKTVEEAWELSNKAVAEALDGLPPVKMHCSVLAEEAIHKAINDYRQRQGLxxxxxxxxxxxxxxxx
PF01592         ELVKGKTVDEALALKNTDIFEELMGLPPVKIHCSVLADAALKAAVSKYPARIAL----------------


                         +         .         .         .         .         *         .:210
query           xx
PF01592         --