[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for cper0:BAB81560.1

[Show Plain Result]


## Summary of Sequence Search
    1::219
    6::210     5e-16  30%  211 aa  PF01168 Ala_racemase_N "Alanine racemase, N-terminal domain"
    1::219

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxIKENLTKFTEKIPSNVQLIAVSKTRTIEEMEEAYEFGIRKFGENKVQEIIRKFDEFHQDVEWHLIGHL
PF01168         --LRHNIAAAAERA-GRKKLRAVSKTAYGHAIRAAYAAGARGFGENTLQEALQL-----QSNGAKILGGF


                         .         .         *         .         .         .         .:140
query           QTNKVKYIVDKVHLIQSLDSIKLLKEIEKVYGKHNKIANTLIQVNIGREEQKYGXXXXXXXXXXXXXXXC
PF01168         DPRELAELAENLDLVHSVDSEEQAEALEKAAAKAGKPLRVLLKVDTGMERS--GVRPEEALELAEAIAAL


                         +         .         .         .         .         *         .:210
query           NNVNVLGIMTIIPKGTEEECRKYFSKTHXXXXXXXXXXXXNIKMDILSMGMSGDYEIATEEGSNMVRIGQ
PF01168         PGLRLVGLMTHFAHADEEETRRQFARLRELADALEAAGLPLLE---LSMGMSADFEAAIEEGSTEVRVGS


                         .         .         .         +         .         .         .:280
query           GIFGKRxxx
PF01168         ALFGAR---