[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for cper0:BAB81632.1

[Show Plain Result]


## Summary of Sequence Search
    1::507
    5::109     1e-10  33%  112 aa  PF02518 HATPase_c "Histidine kinase-, DNA gyrase B-, and HSP90-like
    7::68      3e-06  38%   69 aa  PF00512 HisKA "His Kinase A (phosphoacceptor) domain"
   16::67      3e-04  27%   69 aa  PF00672 HAMP "HAMP domain"
    1::507

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02518         ----------------------------------------------------------------------
PF00512         ----------------------------------------------------------------------
PF00672         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02518         ----------------------------------------------------------------------
PF00512         ----------------------------------------------------------------------
PF00672         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxYVFSNLISKPLVKLN
PF02518         ----------------------------------------------------------------------
PF00512         ----------------------------------------------------------------------
PF00672         -------------------------------------------------------WLLARRLTRPLRRLA


                         .         .         .         +         .         .         .:280
query           KSAKKMSAMDFSEKCDIEREDEIGNLAKTLNFLSKNLxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxA
PF02518         ----------------------------------------------------------------------
PF00512         ---------------------------------------------------------------------A
PF00672         EAAERIAEGDLSVRIPVDGRDEIGELARAFNTMVDRL---------------------------------


                         .         *         .         .         .         .         +:350
query           GASHELKTPIGIISGYAEGIKDGIVDHKDQGVYLDIIIDEAEKMNKLVMDMLELSKLEAxxxxxxxxxxx
PF02518         ----------------------------------------------------------------------
PF00512         GVAHELRTPLTAIRGNAELLLEGTLPDEELRELLETIEEGAERLLRLINDLLDLSRLES-----------
PF00672         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxKIEQVLTNFVTNAIKYSEPNNQIIIDIKPV
PF02518         ----------------------------------------RLRQILRNLVSNAIKATPEGGRITVTIK-L
PF00512         ----------------------------------------------------------------------
PF00672         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           EEDKIYFSIENTGAHIPDSDINKIWTQFYRGDTSRNRGSRSTGLGLSIVKNLLQAHESEFGVMNTENGVK
PF02518         DGGDLTIEVEDNGIGIPPELLERLFEPFFQTDDSDSRKYGGTGLGLSIVRQLAELMGGTITVESKPGGTT
PF00512         ----------------------------------------------------------------------
PF00672         ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           FYFTLxxxxxxxxxxxx
PF02518         FTFTL------------
PF00512         -----------------
PF00672         -----------------