[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for cper0:BAB81731.1

[Show Plain Result]


## Summary of Sequence Search
    1::434
    2::95      3e-12  39%   97 aa  PF00919 UPF0004 "Uncharacterized protein family UPF0004"
    1::152     7e-10  39%  164 aa  PF04055 Radical_SAM "Radical SAM superfamily"
    1::434

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGRARRQNPEA
PF00919         --IYFKTFGCAMNSSDSEFMMGLLSNYGYQFVKNIEDADIVIVNTCTVRNPAEEKMKTIIGYVNNLNPRI
PF04055         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           IIAVVGCYAQIAPTEVSGIEGVDVVxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00919         KIIVCGCVAQAEGDEILKRAPVDLV---------------------------------------------
PF04055         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEIRSLAEHGFKEIILSGIHTASYGVDLDEKVT
PF00919         ----------------------------------------------------------------------
PF04055         -----LVVTRGCNLRCTFCDNPETRGFGRSLSVEEILEELEELAELGVKEVILGGGEPLLYP-------D


                         .         .         .         +         .         .         .:280
query           LVDLLEEIEKIDGIERVRIGSIDPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYE
PF00919         ----------------------------------------------------------------------
PF04055         FVELLLRLAKED-LPGIRIGTLDPELLDELAE---LGLDRLA----IGLQSLDDEVLKAINRGHTLEEIL


                         .         *         .         .         .         .         +:350
query           DIVNLLRDKIEDVSITTDVIVGFPGxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00919         ----------------------------------------------------------------------
PF04055         EAIELLRE--AGFKVVTHLIVGLPG---------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00919         ----------------------------------------------------------------------
PF04055         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxx
PF00919         --------------
PF04055         --------------