[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for cper0:BAB81831.1

[Show Plain Result]


## Summary of Sequence Search
    1::202
    1::144     3e-13  36%  145 aa  PF01467 CTP_transf_2 "Cytidylyltransferase"
    1::202

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxVFGGTFDPIHIGHIYIAYEAYKILELDEVIFMPAGNPPHKKWKDITDEIIRYEMVKKAIEPYSFF
PF01467         -----LYGGSFDPIHNGHLRLLERAKELGDL-LVVGVPSDASPHKDKKPLFSLEERLEMLELAVDP----


                         .         .         *         .         .         .         .:140
query           SINNYEIEKKGLSFTYETLRYLHESFKEVELYFITGADCLVNLNSWKNINEIFKFSNLVVFNRPGFDKND
PF01467         ---NVEVD----------------DFEDLKVDFVIGADLLLSFRGWRDVEDILEEFGIVVVNRGG---DD


                         +         .         .         .         .         *         .:210
query           LLKRKEEFDREYCTNIVYLDLLNIEISSTLIRExxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01467         DLETIFEILDKYPANIILVDPPPNDISSTDIRE-----------------------------