[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for cper0:BAB81914.1

[Show Plain Result]


## Summary of Sequence Search
    1::535
    1::272     e-106  66%  274 aa  PF06418 CTP_synth_N "CTP synthase N-terminus"
    2::182     3e-23  44%  185 aa  PF00117 GATase "Glutamine amidotransferase class-I"
   47::214     1e-08  34%  214 aa  PF07722 Peptidase_C26 "Peptidase C26"
    2::53      2e-05  52%  151 aa  PF07685 GATase_3 "CobB/CobQ-like glutamine amidotransferase domain"
    1::535

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxTKYVFVTGGVVSSLGKGITAASLGRLLKNRGLSVSIQKFDPYLNIDPGTMSPYQHGEVFVTDDGAE
PF06418         ----TKYIFVTGGVVSSLGKGITAASLGALLKARGLKVTSIKIDPYLNVDPGTMSPYQHGEVFVTDDGAE
PF00117         ----------------------------------------------------------------------
PF07722         ----------------------------------------------------------------------
PF07685         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           TDLDLGHYERFIDENLTQNSNVTSGRVYWSVISKERKGEYLGGTVQVIPHITNAIKDRVHRVGKERDXXX
PF06418         TDLDLGHYERFLDIKLTRDNNITTGKIYSSVIEKERRGDYLGKTVQVIPHITDEIKERIERVAKEGEPDV
PF00117         ----------------------------------------------------------------------
PF07722         ----------------------------------------------------------------------
PF07685         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           XXXXXXXXXXXXXSLPFLEAIRQIKYDVGKENVCFIHVTLVPYLGKAGELKTKPTQHSVKELRSIGIQPD
PF06418         CIIEIGGTVGDIESLPFLEAIRQLRFEVGRENFLFIHVTLVPYIAAAGEQKTKPTQHSVKELRSIGIQPD
PF00117         ----------------------------------------------------------------------
PF07722         ----------------------------------------------------------------------
PF07685         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           IIVCRSEKELSEDIKKKIGLFCNIDASEVIQNLDAEHLYAVPLMLHKEGLDRLVCEKLGLGCRDIDxxxx
PF06418         ILVCRSERPLPEETKEKIALFCNVPEEAVISAHDVDSIYEVPLLLEEQGLDDYVLERLGLDAPEPD----
PF00117         ----------------------------------------------------------------------
PF07722         ----------------------------------------------------------------------
PF07685         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxLHDAYISVVEALNHGGLSNDTNVEIEWINAEDVTKENVDELLSGVD
PF06418         ----------------------------------------------------------------------
PF00117         ------------------------LIDAYDSFTENLARA--LRELGAEVEVVPNDS---DALEILLLNPD
PF07722         ----------------------------------------------------------EEDLEELLELLD
PF07685         --------------------------------------------------------------DELLPDAD


                         .         .         .         .         *         .         .:420
query           GVLVPGGFGDRGVEGKIEAIRWARENKKPFLGICLGMQCAVIEYARNVLGLEGAHSSELNPETPFPVIDL
PF06418         ----------------------------------------------------------------------
PF00117         GILVSGGPGSPGIEGKIEAIKYARENGVPVLGICLGMQLLAEAFGGKVVKAKVPHH--------------
PF07722         GLLLTGGYGEEAIDPERDAIRAALERGIPVLGICRGMQLLNV-------ALGGTLYQDI-PDQP----GL
PF07685         LVVLPGGFSDLALSGLMEAIREFAEKGGPVLGICGGFQ--------------------------------


                         .         .         +         .         .         .         .:490
query           MPEQKDVEDLGGTMRLGLYPCKLEDNTFCKDVYASDLIYERHRHRYEFNNEYRTQLIESGLTIAGTSPDG
PF06418         ----------------------------------------------------------------------
PF00117         ----------GGNMRLGHDGSPL--------FYGPEVFYVRHRHSYEVNP------LPEGLEVLATSEDG
PF07722         LDHREHPQD-GPSHEVRIEPGSL----LARLLGAEEIMVNSLHHQA-------IKRLGPGLRVEATAPDG
PF07685         ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           RLVECVEVKDHPWFVAVQYHPELKSRPNRPHPLFVGFxxxxxxxx
PF06418         ---------------------------------------------
PF00117         GTIMAIVHKDNPFF-GVQFHPESSSTPGGLHLLFNFF--------
PF07722         -LIEAIESPDAPYFIGVQWHPE-----------------------
PF07685         ---------------------------------------------