[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for cper0:BAB81922.1

[Show Plain Result]


## Summary of Sequence Search
    1::78
    5::76      1e-14  56%   76 aa  PF06257 DUF1021 "Protein of unknown function (DUF1021)"
    1::78

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxLNSIRKSIEDHVGEKVKLRANGGRKKILENEGILESVHPSIFVVRLQKDTQRKVTYSYSDVLTK
PF06257         ------LKEIKKDLDAHVGQRVELKANGGRKKTVEREGVLIETYPSVFVVELEEDNFYRVSYSYSDVLTE


                         .         .         *         .         .         .         .:140
query           TVQLDFxx
PF06257         TVELTF--