[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for cper0:BAB82028.1

[Show Plain Result]


## Summary of Sequence Search
    1::643
    1::141     4e-17  34%  170 aa  PF00587 tRNA-synt_2b "tRNA synthetase class II core domain (G, H,
    4::90      2e-11  34%   91 aa  PF03129 HGTP_anticodon "Anticodon binding domain"
    1::60      2e-06  35%   60 aa  PF02824 TGS "TGS domain"
    6::44      2e-05  61%   44 aa  PF07973 tRNA_SAD "Threonyl and Alanyl tRNA synthetase second
    1::643

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xIKITLKDGSIKEVEAGLSIFEIAQSISQGLARNACCGILNGKVEDLRFIVNEDSSLEICTxxxxxxxxx
PF00587         ----------------------------------------------------------------------
PF03129         ----------------------------------------------------------------------
PF02824         -IRVTTPDGSVKELPKGSTPLDFAYSIHKSLAKAFVAAKVNGQLVDLSHPLEDDDVVEIVT---------
PF07973         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00587         ----------------------------------------------------------------------
PF03129         ----------------------------------------------------------------------
PF02824         ----------------------------------------------------------------------
PF07973         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxIGDFVDLCAGPHLMAVKPIKAVKLLRSTGAYWKGDEKNK
PF00587         ----------------------------------------------------------------------
PF03129         ----------------------------------------------------------------------
PF02824         ----------------------------------------------------------------------
PF07973         -------------------------------IGEFVDLCGGTHVPNTGEIGAFKLLR-------GDEKNA


                         .         .         .         +         .         .         .:280
query           MLSRVYxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxIIQTLQRWIE
PF00587         ------------------------------------------------------------IKRALEQFWR
PF03129         ----------------------------------------------------------------------
PF02824         ----------------------------------------------------------------------
PF07973         GLQRIY----------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           DEEQRRGYVLTKTPLMAKSDLYKISGHWDHYKDGMFVLGDEEKDSEVFALRPMTCPFQYAIYNSTQHSYR
PF00587         EEFVEYGYEEIDTPILEPYELLKASGHVDKFADEMYKFKD--RGGRDLYLRPETTQPIARNFKNLLLSYR
PF03129         ----------------------------------------------------------------------
PF02824         ----------------------------------------------------------------------
PF07973         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           DLPVRFAETSTLFRNESSGEMHGLIRVRQFTLADGHIVCTPEQLEDEFKNTVDLVKYVMETLGIxxxxxx
PF00587         KLPLRLAQIGKVFRNEIRPR-RGLGRVREFTQVEAEIFGTPEQSNEELAEMIALAEEFLEKLGL------
PF03129         ----------------------------------------------------------------------
PF02824         ----------------------------------------------------------------------
PF07973         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00587         ----------------------------------------------------------------------
PF03129         ----------------------------------------------------------------------
PF02824         ----------------------------------------------------------------------
PF07973         ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxVLPLSDKYADY
PF00587         ----------------------------------------------------------------------
PF03129         -----------------------------------------------------------VIPLGDELLDY
PF02824         ----------------------------------------------------------------------
PF07973         ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           ANXXXXXXXXXXXXXXADHRAEKIGYKIREARLERTPYILVVGEKEAENKEVSVRSRKNGEEGAMPLADF
PF00587         ----------------------------------------------------------------------
PF03129         AQELAAELRAAGIRVELDDSSGSLGKKIKRADLRGIPYAIIVGEKELEDGTVTVKDRDTGEQETVPLDEL
PF02824         ----------------------------------------------------------------------
PF07973         ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           VNRIVLxxxxxxx
PF00587         -------------
PF03129         VEYLKL-------
PF02824         -------------
PF07973         -------------