[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for cper0:BAB82040.1

[Show Plain Result]


## Summary of Sequence Search
    1::99
    4::87      2e-20  59%   88 aa  PF01371 Trp_repressor "Trp repressor protein"
    1::99

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxDFLFEAILKLEDINECYNFFEDICTISELKALAQRLHVAKMLREKKTYTEIAEETKA
PF01371         -------------DQLFEALLSLKDEEECYPFLEDLLTPDEREALAQRLRVAKLLRGGKSQREIAEELGA


                         .         .         *         .         .         .         .:140
query           STATISRVNRCLNYGADGYNNILNRLxxx
PF01371         SIATITRVSNSLKYGSDGYKEWLERL---