[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for cper0:BAB82239.1

[Show Plain Result]


## Summary of Sequence Search
    1::192
  236::306     7e-04  30%  356 aa  PF06122 TraH "Conjugative relaxosome accessory transposon protein"
    1::192

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxSIMTGQGELITTGLTESSEGAVKFIISLVGIMCFWCGVMKIAENSGLTSKVAKL
PF06122         ----------------SSLTADGNLITALLNGGTGSSAKIYSCDDDDKCLEPSNVTISSDKGLKGQVSDL


                         .         .         *         .         .         .         .:140
query           LNPILKKIFKESSHSDExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF06122         LNSIVDKIASDTALSDD-----------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF06122         ----------------------------------------------------