[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for cper0:BAB82330.1

[Show Plain Result]


## Summary of Sequence Search
    1::293
   84::274     3e-30  40%  275 aa  PF03313 SDH_alpha "Serine dehydratase alpha chain"
    1::293

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF03313         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxGNVMVGAMARALSCSEVNASMGRIVACPTAGSCGILPAVILTVGERLNLSDEE
PF03313         -----------------GDLLDWANAYALAVSEENAAGGRVVAAPTNGSAGIIPAVLYYY-EEFGLSEEK


                         +         .         .         .         .         *         .:210
query           LIQGLLASSAVGMIIAQNATLXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPEMALDAGAIVFKNILGLVC
PF03313         LARALLLAGAIGILIKNNASISGAECGCQAEVGSASAMAAAGLAYLLGGSPEQVENAAEIALEHNLGLTC


                         .         .         .         +         .         .         .:280
query           DPIAGLVEVPCAKRNFAGAVSALTTADLVMAGIHSKIPFDDTVEAMYRVGKSLPASLRETALGGLAIxxx
PF03313         DPVAGLVQVPCIERNAIGAVKAINAARMALAGIDGGISLDEVIETMRNTGKDMPEKYKETSLGGLAV---


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxx
PF03313         -------------