[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for cper0:BAB82333.1

[Show Plain Result]


## Summary of Sequence Search
    1::241
    3::140     2e-21  37%  141 aa  PF07702 UTRA "UTRA domain"
    4::64      1e-08  49%   64 aa  PF00392 GntR "Bacterial regulatory proteins, gntR family"
    1::241

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxQLETELIDLINSGELKENDKLPSERELCEQYNVSRTTARQAIGELERKEYVYKVHGKG
PF07702         ----------------------------------------------------------------------
PF00392         ------------QIYEQLREAILSGELPPGDRLPSERELAEELGVSRTTVREALRRLEAEGLVERRPGRG


                         .         .         *         .         .         .         .:140
query           TFIxxxxxxxxxxxxxxxxxxxxxxGKNPSSKILSFDLIRADNKISEKLKVEENSLVYKIVRLRIADEVP
PF07702         -------------------------GRKPSSKVLSFEVVPADAEVAEALGLEPGDPVYRIERLRYADGEP
PF00392         TFV-------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           MMVECTYLPEYRFIDLKEKMLKEKPMYDIFREVYNVSLTKAKESFKPILISKSDSKLLNVEDGTAAMRIE
PF07702         VALEESYLPAELFPGLTAEDLEEGSLYALLEEEYGLPITRAEQEIEAVLATAEEAELLGIPPGSPVLVIE
PF00392         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           RVTFENERVIEYTVSVSRGDKFxxxxxxxxx
PF07702         RVTYDEDRPVEYSESYYRGDRY---------
PF00392         -------------------------------