[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for cper0:BAB80017.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1efpB.bssp"
#ERROR : Can't open dsspfile "1o94C.bssp"
#ERROR : Can't open dsspfile "1o94D.bssp"
#ERROR : Can't open dsspfile "2ozgA1.bssp"
#ERROR : Can't open dsspfile "1vl6A1.bssp"
#ERROR : Can't open dsspfile "2p3pA1.bssp"
#ERROR : Can't open dsspfile "1e1cB2.bssp"

## Summary of PDB Search
:262
    7e-50  24%  1efpB  [c.26.2.3] PROTEIN (ELECTRON TRANSFER FLAVOPROTEIN)
    1e-38  27%  1o94C  [c.26.2.3] ELECTRON TRANSFER FLAVOPROTEIN BETA-SUBUNIT
    2e-23  15%  1o94D  [c.26.2.3] ELECTRON TRANSFER FLAVOPROTEIN ALPHA-SUBUNIT
    3e-21  14%  2ozgA1 [d.106.1.4] GCN5-RELATED N-ACETYLTRANSFERASE A:291 -- 395
    2e-04  15%  1vl6A1 [c.2.1.7] MALATE OXIDOREDUCTASE A:155 -- 376
    5e-04  13%  2p3pA1 [d.383.1.1] HYPOTHETICAL PROTEIN A:66 -- 262
    6e-04  20%  1e1cB2 [c.23.6.1] METHYLMALONYL-COA MUTASE BETA CHAIN B:476 -- 638
:262

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKIMVCIKQVPGTSKVEVDEKTGVLKRDGVDSKMNPYDLYALETALRIKEKKGGNIKVISMGPPQAKAVI
1efpB           MKVLVPVKRLIDYVKARVKSDGSGVDLANVKMSMNPFDEIAVEEAIRLKEKGQAEIIAVSIGVKQAAETL
1o94C           MKILVAVKQTAALEDFEIRDGMDV-DEDFMMYDLNEWDDFSLEEAMKIKESSDDEVVVVSVGPDRVDESL
1o94D           --------------------KILVI-AEHRRNDLRPVSLELIGAANGLKKSGEDKVVVAVIGSQ-ADAFV
2ozgA1          ----------------------------------------------------------------------
1vl6A1          --------------------------------------SAAFLNALKLTEKKIEEVKVVVNGIAAGYNIV
2p3pA1          ----------------------------------SRIDFYTTEWKPLKTDRFWQQIEDFFLPHT------
1e1cB2          -------------------------------------DFGGREGFSSPVWHIAG-IDTPQVEGGTTAEIV


                         .         .         *         .         .         .         .:140
query           KEAYSMGADEGTLVSDRKFAGADVLATSYTLSQGVKKCGDFDIILCGKQTTDGDTAQVGPEMAEYLGIPH
1efpB           RTALAMGADRAILVVAADDVQQDIEPLAVAILAAVARAEGTELIIAGKQAIDNDMNATGQMLAAILGWAQ
1o94C           RKCLAKGADRAVRVWDDAAEGSDAIVVGRILTEVIKK-EAPDMVFAGVQSSDQAYASTGISVASYLNWPH
1o94D           PALSVNGVDELVVVKGSSIDF-DPDVFEASVSALIAAHN-PSVVLLPHSVDSLG---YASSLASKTGYGF
2ozgA1          ---------------------------------------NVCKALEARGPLGVEAELHLEVQDDLLATNQ
1vl6A1          KFLLDLGV--------KNVVAVD--------RKGILNENDPETCLNEYHLRITNPERLSGDLETALSRGN
2p3pA1          --------DRQSYAYQAIYASLTP---------------SYXQVSLSE---ESDTLSIRQTVTETLAEEE
1e1cB2          EAFKKSGAQVADLCSSAKVYAQQGLE----VAKALKAAGAKALYLSGAFKEFGDDAEKLIDGRLFMGMDV


                         +         .         .         .         .         *         .:210
query           VANVRRILDVNDDFIKVEMDMPNTIEVLEVKYPCLLTVDKDIFQPRLPSYKKKLETDEREINVISLNDFE
1efpB           ATFASKV-EIEGAKAKVTREVDGGLQTIAVSLPAVVTADLRLNEPRYASLPNIMKAKKKPLDEKTAADYG
1o94C           AAVVADLKPGDNKAVIRRELEGGMLQEVEINCPAVLTIQLGINKPRYASLRGIKQAATKPIEEVSLADIG
1o94D           ATDVYI-VEYQGDELVATRGGYNQKVNVEVDFTVVLTIRPSVFKPLEGAGSPVVSNVDAPSVQSRSQNKD
2ozgA1          GKFI---LSVANGKSEVTKGGKGELQLDIKGLASLYTSL---FTPRQLQLTGKLQATETALLKATQIFA-
1vl6A1          ILKPEWIKKXSRKPVIFALANPVPEIDPELEAGAFIVATGRSDHP-------------------------
2p3pA1          KP--------------------------------------------------------------------
1e1cB2          VDTLSSTLD-------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           DKDEKKYGLNGSPTQVERIFPPxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1efpB           VDV-------APRLEVVSVREP------------------------------
1o94C           L-SANDVGAAQSMSRVRRMYIP------------------------------
1o94D           ----------------------------------------------------
2ozgA1          ----------------------------------------------------
1vl6A1          ----------------------------------------------------
2p3pA1          ----------------------------------------------------
1e1cB2          ----------------------------------------------------