[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for cper0:BAB80140.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2fiwA1.bssp"
#ERROR : Can't open dsspfile "1ozpA.bssp"
#ERROR : Can't open dsspfile "1vkcA.bssp"
#ERROR : Can't open dsspfile "2fsrA1.bssp"
#ERROR : Can't open dsspfile "2fl4A1.bssp"
#ERROR : Can't open dsspfile "1on0A.bssp"
#ERROR : Can't open dsspfile "1i12A.bssp"
#ERROR : Can't open dsspfile "1u6mA.bssp"
#ERROR : Can't open dsspfile "1tiqA.bssp"
#ERROR : Can't open dsspfile "1y9kA1.bssp"
#ERROR : Can't open dsspfile "1z4eA1.bssp"
#ERROR : Can't open dsspfile "1lrzA3.bssp"
#ERROR : Can't open dsspfile "1y9wA1.bssp"
#ERROR : Can't open dsspfile "2euiA1.bssp"
#ERROR : Can't open dsspfile "2ae6A1.bssp"
#ERROR : Can't open dsspfile "1yx0A1.bssp"
#ERROR : Can't open dsspfile "1cm0A.bssp"
#ERROR : Can't open dsspfile "1mk4A.bssp"
#ERROR : Can't open dsspfile "1nslA.bssp"
#ERROR : Can't open dsspfile "1ro5A.bssp"
#ERROR : Can't open dsspfile "1bobA.bssp"
#ERROR : Can't open dsspfile "1yk3A1.bssp"
#ERROR : Can't open dsspfile "2ge3A1.bssp"
#ERROR : Can't open dsspfile "1b6bA.bssp"
#ERROR : Can't open dsspfile "2atrA1.bssp"
#ERROR : Can't open dsspfile "1xebA.bssp"
#ERROR : Can't open dsspfile "1xmtA.bssp"
#ERROR : Can't open dsspfile "1s3zA.bssp"
#ERROR : Can't open dsspfile "1vhsA.bssp"
#ERROR : Can't open dsspfile "2a6aA2.bssp"
#ERROR : Can't open dsspfile "2b3uA1.bssp"
#ERROR : Can't open dsspfile "2fiaA1.bssp"
#ERROR : Can't open dsspfile "2ozgA2.bssp"
#ERROR : Can't open dsspfile "2bswA1.bssp"
#ERROR : Can't open dsspfile "1wwzA1.bssp"
#ERROR : Can't open dsspfile "1gheA.bssp"
#ERROR : Can't open dsspfile "2ganA1.bssp"
#ERROR : Can't open dsspfile "1yreA1.bssp"
#ERROR : Can't open dsspfile "1y7rA1.bssp"
#ERROR : Can't open dsspfile "2i6cA1.bssp"
#ERROR : Can't open dsspfile "1wk4A.bssp"
#ERROR : Can't open dsspfile "1s7fA1.bssp"
#ERROR : Can't open dsspfile "2g3aA1.bssp"
#ERROR : Can't open dsspfile "1m44A.bssp"
#ERROR : Can't open dsspfile "1bo4A.bssp"
#ERROR : Can't open dsspfile "1sqhA.bssp"
#ERROR : Can't open dsspfile "1yr0A1.bssp"
#ERROR : Can't open dsspfile "1q2yA.bssp"

## Summary of PDB Search
:162
    2e-09  21%  2fiwA1 [d.108.1.1] GCN5-RELATED N- A:2 -- 157
    3e-09  21%  1ozpA  [d.108.1.1] HYPOTHETICAL PROTEIN RV0819
    1e-08  20%  1vkcA  [d.108.1.1] PUTATIVE ACETYL TRANSFERASE
    1e-08  14%  2fsrA1 [d.108.1.1] ACETYLTRANFERASE A:4 -- 167
    2e-08  16%  2fl4A1 [d.108.1.1] SPERMINE/SPERMIDINE ACETYLTRANSFERASE A:1 -- 146
    3e-08  20%  1on0A  [d.108.1.1] YYCN PROTEIN
    6e-08  24%  1i12A  [d.108.1.1] GLUCOSAMINE-PHOSPHATE N-ACETYLTRANSFERASE
    8e-08  15%  1u6mA  [d.108.1.1] ACETYLTRANSFERASE, GNAT FAMILY
    1e-07  19%  1tiqA  [d.108.1.1] PROTEASE SYNTHASE AND SPORULATION NEGATIVE
    1e-07  20%  1y9kA1 [d.108.1.1] IAA ACETYLTRANSFERASE A:1 -- 152
    1e-07  19%  1z4eA1 [d.108.1.1] TRANSCRIPTIONAL REGULATOR A:4 -- 153
    1e-07  11%  1lrzA3 [d.108.1.4] FACTOR ESSENTIAL FOR EXPRESSION OF METHICILLIN
    2e-07  15%  1y9wA1 [d.108.1.1] ACETYLTRANSFERASE A:1 -- 140
    2e-07  19%  2euiA1 [d.108.1.1] PROBABLE ACETYLTRANSFERASE A:1 -- 153
    2e-07  25%  2ae6A1 [d.108.1.1] ACETYLTRANSFERASE, GNAT FAMILY A:1 -- 161
    2e-07  23%  1yx0A1 [d.108.1.1] HYPOTHETICAL PROTEIN YSNE A:1 -- 151
    5e-07  22%  1cm0A  [d.108.1.1] P300/CBP ASSOCIATING FACTOR
    5e-07  21%  1mk4A  [d.108.1.1] HYPOTHETICAL PROTEIN YQJY
    7e-07  12%  1nslA  [d.108.1.1] PROBABLE ACETYLTRANSFERASE
    8e-07   8%  1ro5A  [d.108.1.3] AUTOINDUCER SYNTHESIS PROTEIN LASI
    8e-07  14%  1bobA  [d.108.1.1] HISTONE ACETYLTRANSFERASE
    2e-06  11%  1yk3A1 [d.108.1.1] HYPOTHETICAL PROTEIN RV1347C/MT1389 A:10 -- 207
    2e-06  27%  2ge3A1 [d.108.1.1] PROBABLE ACETYLTRANSFERASE A:6 -- 169
    2e-06  19%  1b6bA  [d.108.1.1] PROTEIN (ARYLALKYLAMINE N-ACETYLTRANSFERASE)
    2e-06  26%  2atrA1 [d.108.1.1] ACETYLTRANSFERASE, GNAT FAMILY A:1 -- 137
    2e-06  14%  1xebA  [d.108.1.1] HYPOTHETICAL PROTEIN PA0115
    3e-06  14%  1xmtA  [d.108.1.1] PUTATIVE ACETYLTRANSFERASE
    3e-06  20%  1s3zA  [d.108.1.1] AMINOGLYCOSIDE 6'-N-ACETYLTRANSFERASE
    4e-06  20%  1vhsA  [d.108.1.1] SIMILAR TO PHOSPHINOTHRICIN ACETYLTRANSFERASE
    4e-06  10%  2a6aA2 [c.55.1.9] HYPOTHETICAL PROTEIN TM0874 A:104 -- 193
    5e-06  12%  2b3uA1 [d.108.1.1] DIAMINE ACETYLTRANSFERASE 1 A:2 -- 170
    6e-06  21%  2fiaA1 [d.108.1.1] ACETYLTRANSFERASE A:1 -- 157
    7e-06  17%  2ozgA2 [d.108.1.10] GCN5-RELATED N-ACETYLTRANSFERASE A:8 -- 290
    8e-06  22%  2bswA1 [d.108.1.1] GLYPHOSATE N-ACETYLTRANSFERASE A:2 -- 146
    2e-05  20%  1wwzA1 [d.108.1.1] HYPOTHETICAL PROTEIN PH1933 A:1 -- 157
    4e-05  11%  1gheA  [d.108.1.1] ACETYLTRANSFERASE
    4e-05  31%  2ganA1 [d.108.1.1] 182AA LONG HYPOTHETICAL PROTEIN A:1 -- 182
    4e-05  14%  1yreA1 [d.108.1.1] HYPOTHETICAL PROTEIN PA3270 A:11 -- 193
    9e-05  19%  1y7rA1 [d.108.1.1] HYPOTHETICAL PROTEIN SA2161 A:1 -- 133
    1e-04  19%  2i6cA1 [d.108.1.1] PUTATIVE ACETYLTRANSFERASE A:1001 -- 1160
    2e-04  13%  1wk4A  [d.108.1.1] TTK003001606
    2e-04  12%  1s7fA1 [d.108.1.1] ACETYL TRANSFERASE A:1 -- 176
    2e-04  14%  2g3aA1 [d.108.1.1] ACETYLTRANSFERASE A:1 -- 137
    3e-04   9%  1m44A  [d.108.1.1] AMINOGLYCOSIDE 2'-N-ACETYLTRANSFERASE
    3e-04  22%  1bo4A  [d.108.1.1] PROTEIN (SERRATIA MARCESCENS AMINOGLYCOSIDE-3-N-
    4e-04  24%  1sqhA  [d.108.1.5] HYPOTHETICAL PROTEIN CG14615-PA
    6e-04  19%  1yr0A1 [d.108.1.1] PHOSPHINOTHRICIN ACETYLTRANSFERASE A:4 -- 166
    8e-04  18%  1q2yA  [d.108.1.1] SIMILAR TO HYPOTHETICAL PROTEINS
:162

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxLPDGYRFTDFRIGDENNWAYIQYSAGVFKDYQLAIRRIFKEENSLK
2fiwA1          ---------------------------------YLPEDAAVTAAIFVASLTADDYQEAWASAADDEAKFA
1ozpA           ----------------------------------------------------------------AERRGE
1vkcA           ----------------------------------KLDREISYSFVRFPIS-YEEYEERHEELFE---SLL
2fsrA1          ---------------------------------------------------PYDLPSTWGVFCHDLANWH
2fl4A1          ----------------------------IHFEKVTSDNRKAVENLQVFAEQQAFIESMAENLKESDQF--
1on0A           ----------------------------------------------------------------------
1i12A           ------------------------LPDGFYIRRMEEGDLEQVTETGTITPESFCKLIKYWNEATVWNDKK
1u6mA           ----------------------------------------------------------------------
1tiqA           -------------------------------------DTFKEQNSPENXKAYLESAFNTEQLEKELSNX-
1y9kA1          ----------------------------------------------------------------SERQIA
1z4eA1          ----------------------------------------------------------------------
1lrzA3          ---------------------------------------------------------IFRSFMDDKFYLK
1y9wA1          -----------------------------------------------------------------TDEVK
2euiA1          ----------------------------------------------------------------------
2ae6A1          ----------------------------------------------------------------------
1yx0A1          ----------------------------------------------------------------------
1cm0A           ----------------------------------------------------------------------
1mk4A           ----------------------------------------------------------------------
1nslA           ---------------------------------------IIQNQQRLGKWLFFSSADTYRETIIPDWRRQ
1ro5A           --------------------------------------ERKGWDVSVIDEMEIDGYDALSPYYQEDGQVF
1bobA           ----------------------------FVVYKSSLVDDFARRMHRRVQIFSLLFIEAANYIDETDPSW-
1yk3A1          -------------------------EPPYGLRVAQLTDAEMLAEWMNRPHLAAAWEYDWPASRWRQHLNA
2ge3A1          ----------------------------------------------------------------------
1b6bA           ----------------------------------------------------------------------
2atrA1          ----------------------------------------------------------------------
1xebA           ----------------------------------------------------------------------
1xmtA           ----------------------------------------------------------------------
1s3zA           ----------------------------------------------------------------------
1vhsA           ----------------------------------------------------------------------
2a6aA2          ----------------------------------------------------------------------
2b3uA1          ----------------------------------------------------------------------
2fiaA1          ----------------------------------------------------------------------
2ozgA2          ----------------------------------------------------------------------
2bswA1          ----------------------------------------------------------------------
1wwzA1          ----------------------------------------------------------------------
1gheA           -----------------------------------------ASVGFXADLDXQQAYAWCDGLKADIAA--
2ganA1          ----------------------------------------------------------------------
1yreA1          -----------------------------------------VSLAEANREALQYMDGPTRPDWYRQSLAE
1y7rA1          ---------------------------------------------IPTCEDYCALRINAGXSPKTREAAE
2i6cA1          ----------------------------------------------------------------------
1wk4A           --------------------------------------ATYRGVVPEAFLEGLSYEGQAERWAQRLKTPT
1s7fA1          ---------------------------------------VLKNKAWLQQSLDWPTSQEETRKHVQGNILL
2g3aA1          ------------------------------------------------------------VAYNLARFGE
1m44A           ----------------------------------------------------------------------
1bo4A           ----------------------------------------------------------------------
1sqhA           ----------------------------------------------------------------------
1yr0A1          ----------------------------------------------------------------------
1q2yA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           GNFKNRCVFLENENGERIGTIMIVPSLSEEEGVQEIKYLALLPKYQEQGLGKLLISKAYKMVDDVEGATR
2fiwA1          ARLSGQLTLIATLQGVPVGFASL-------KGPDHIDXLYVHPDYVGRDVGTTLIDALEK-LAGARGALI
1ozpA           AWFDPDGLILAFGDGRLLGFHWTKVH-PDHPGLGEVYVLGVDPAAQRRGLGQMLTSIGIVSLARRLVEPA
1vkcA           SQGEHKFFVALNERSELLGHVWICITLDTVDYVKIIYDIEVVKWARGLGIGSALLRKAEEWAKE-RGAKK
2fsrA1          FFGHGALXIDLGETGECIGQIGINHG---PLFPEKELGWLLYEGHEGRGYAAEAAVALRDWAFETLNLPT
2fl4A1          ---PEWESAGIYDGNQLIGYAMYGRW---QDGRVWLDRFLIDQRFQGQGYGKAACRLLMLKLIEKYQTNK
1on0A           ----HHLWSLKLNEKDIVGWLWIHAEPEHPQQEAFIYDFGLYEPYRGKGYAKQALA-ALDQAARSXGIRK
1i12A           IMQYNPMVIVDKRTETVAATGNIIIIIHELGLCGHIEDIAVNSKYQGQGLGKLLIDQLVTIGFD-YGCYK
1u6mA           ------EVFKKHGLAEDVRLFIEEE---TLPNEWYLDTISVDERFRGMGIGSKLLDALPEVAKA-SGKQA
1tiqA           ----SSQFFFIYFDHEIAGYVKVNISEEXGAESLEIERIYIKNSFQKHGLGKHLLNKAIEIALE-RNKKN
1y9kA1          TYVQRGLTYVAKQGGSVIGVYVLLET---RPKTXEIXNIAVAEHLQGKGIGKKLLRHAVETAKG-YGXSK
1z4eA1          ----NNELIVACNGEEIVGMLQVTFTPYLTYWRATIEGVRTHSAARGQGIGSQLVCWAIERAKE-RGCHL
1lrzA3          YYKDRVLVPLAYINELPISAGFFFI----NPFEVVYYAGGTSNAFRHFAGSYAVQWEMINYALN-HGIDR
1y9wA1          QPMEEVSLVVKNEEGKIFGGVTGTMYFYH----LHIDFLWVDESVRHDGYGSQLLHEIEGIAKE-KGCRL
2euiA1          ------YLALADEEDRLLGFCQLYPSFSSLSLVWILNDIYVAEEARRQLVADHLLQHAKQXARE-THAVR
2ae6A1          ---KDETIFVAISGQQLAGFIEVHPPTSAAHQKQWLLSIGVSPDFQDQGIGGSLLSYIKDXAEI-SGIHK
1yx0A1          ------TFWSAWEGDELAGCGALKE-LDTRHG--EIKSMRTSASHLRKGVAKQVLQHIIEEAEK-RGYER
1cm0A           ----KHKTLALIKDGRVIGGICFRMF--PSQGFTEIVFCAVTSNEQVKGYGTHLM-NHLKEYHIKHDILN
1mk4A           ----QDTSFITSEHNSMTGFLIGFQ-SQSDPETAYIHFSGVHPDFRKMQIGKQLYDVFIETVKQ-RGCTR
1nslA           YADLNGIEAGLLYDGSLCGXISLHNL--DQVNRKAEIGYWIAKEFEGKGIITAACRKLITYAFEELELNR
1ro5A           GCWRILDTTGPYMLKNTFPELLHGKEAPCSPHIWELSRFAINSGQKGSLGFSDCTLEAMRALARYSLQND
1bobA           ----QIYWLLNKKTKELIGFVTTYKYWHYIDKKFKISQFLIFPPYQNKGHGSCLYEAIIQSWLE-DKSIT
1yk3A1          LEGTYSLPLIGSWHGTDGGYLELYWYYDADPYDLGLHAAIADLSKVNRGFGPLLLPRIVAVFANEPRCRR
2ge3A1          ----DHPQFVAIADGDVIGWCDIRRQDRATRAHCGTLGXGILPAYRNKGLGARLXRRTLDAAHE-FGLHR
1b6bA           ----------------------------PRGHSAHLHALAVHRSFRQQGKGSVLLWRYLHHVGAQPAVRR
2atrA1          ------VIYLALDGDAVVGLIRLV---GDGFSSVFVQDLIVLPSYQRQGIGSSLXKEA---LGNFKEAYQ
1xebA           ----DTHHLXAWRDGQLLAYLRLLDP-VRHEGQVVIGRVVSSSAARGQGLGHQLXERALQAAER-LWLDT
1xmtA           --------RFETEDHEAFIEYKMRNN----GKVMDLVHTYVPSFKRGLGLASHLCVAAFEHISIIPSCSY
1s3zA           -QADHLASFIAMADGVAIGFADASINGCDSSPVVFLEGIFVLPSFRQRGVAKQLIAAVQRWGTN-KGCRE
1vhsA           ----RPLYVAEDENGNVAAWISFETYGRPAYNKTAEVSIYIDEACRGKGVGSYLLQEALRIAPN-LGIRS
2a6aA2          -------------DGVVLVAR------RARKGYHYCAVYLKDKGLNPLKEPSVVSDEELEEITK-EFSPK
2b3uA1          ----VPKEHWTPEGHSIVGFAXYYFTYDPWIGLLYLEDFFVXSDYRGFGIGSEILKNLSQVAXR-CRCSS
2fiaA1          ----KKRLYLLVHEEMIFSMATFCMEQEQDFV--WLKRFATSPNYIAKGYGSLLFHELEKRAVW-EGRRK
2ozgA2          ----LENFRVIYREQKVAGGLAILPXGQWWGGQAGIAAVGIAPEYRGDGAAIALIQHTLQEISEQ-DIPI
2bswA1          ----GAFHLGGYYGGKLISIASFHQAEHSELQGQQLRGXATLEGYREQKAGSSLIKHAEEILRK-RGADL
1wwzA1          ----SDGFFVAKVGDKIVGFIVCDKSKYEGRIVGAIHEFVVDKKFQGKGIGRKLLITCLDFLGKYNDTIE
1gheA           ---GSLLLWVVAEDDNVLASAQLSLCQKPNGLNREVQKLXVLPSARGRGLGRQLXDEVEQVAVK-HKRGL
2ganA1          --------YTYQKDNRIIGTIALVYKRIKEKGIWLIEFFVVDPEFQGKGIGSTLLEFAVKRLRDPYVVTF
1yreA1          QREGRALPLAVRLGVQLVGTTRFAEF-LPALPACEIGWTWLDQAQHGSGLNRMIKYLMLKHAFDNLRMVR
1y7rA1          KGLPNALFTVTLYDKDRIGXGRVI---GDGGTVFQIVDIAVLKSYQGQAYGSLIXEHIXKYIKNVSVESY
2i6cA1          ------------------------------------------PAARGLGVARYLIGVXENLAREQYKARL
1wk4A           WPGRLFVAESESGEVVGFAAFGPDRASGFPGYTAELWAIYVLPTWQRKGLGRALFHEGARLLQAEGYGRX
1s7fA1          HQRGYAKMYLIFCQNEMAGVLSFNA--IEPINKAAYIGYWLDESFQGQGIMSQSLQALMTHYARRGDIRR
2g3aA1          SDKRDLNITIRNDDNSVTGGLVGHTA----RGWLYVQLLFVPEAXRGQGIAPKLLAXAEEEARK-RGCXG
1m44A           ----------------------------------YVEGVAVRADWRGQRLVSALLDAVEQVMRGLSSSAR
1bo4A           ----TFIALAAFDQEAVVGALAAYVLPKFEQPRSEIYDLAVSGEHRRQGIATALINLLKHEANA-LGAYV
1sqhA           -----------------------------------LGXLQVLPKAERRGLGGLLAAAXSREIAR-GEEIT
1yr0A1          ---RGFPVIVAILDGKVAGYASYGDWRAFDGYRHTREHVYVHKDARGHGIGKRLXQALIDHAGG-NDVHV
1q2yA           --------------------------WRMKDGYGKLERICVLKSHRSAGVGGIIMKALEKAAAD-GGASG


                         +         .         .         .         .         *         .:210
query           INLEAYNDKSIVLFENLGFERx
2fiwA1          LTVDA-SDNAAEFFAKRGYV--
1ozpA           VLLYVENVAAVRTYQSLGFTT-
1vkcA           IVLRVEIDPAVKWYEERGYKA-
2fsrA1          LVSYVSNRKSAAVAERIGGTL-
2fl4A1          LYLSVYNSSAIRLYQQLGFVF-
1on0A           LSLHAHNQTARKLYEQTGFQE-
1i12A           IILDCDEKN-VKFYEKCGFSN-
1u6mA           LGLNVDNPGARKLYASKGFKD-
1tiqA           IWLGVWEKNAIAFYKKXGFVQ-
1y9kA1          LEVGTGNSSQLALYQKCGFR--
1z4eA1          IQLTTDRPDALRFYEQLGFKA-
1lrzA3          YNFYGEDAGVVKFKKGYNAEI-
1y9wA1          ILLDSFSFQAPEFYKKHGYRE-
2euiA1          XRVSVDNEVAQKVYESIGFRE-
2ae6A1          LSLRATNQEAIRFYEKHGFVQ-
1yx0A1          LSLEASFEPARKLYESFGFQY-
1cm0A           FLTYA-DEYAIGYFKKQGFSK-
1mk4A           VKCVTSNKVSIAYHTKLGFDI-
1nslA           VAIAVGNEKSRAVPERIGFLE-
1ro5A           IQTLVTTVGVEKMMIRAGLDV-
1bobA           EITVEDNEAFDDLRDRNDIQR-
1yk3A1          IMFDPDNTATRRLCEWAGCKF-
2ge3A1          IELSADNARAIALYEKIGFAH-
1b6bA           AVLMC-EDALVPFYQRFGFHP-
2atrA1          VQLATETEKNVGFYRSXGFE--
1xebA           PVYLSAQAHLQAYYGRYGFVA-
1xmtA           VSDTFLNPSWKPLIHSEVF---
1s3zA           MASDTSNTISQKVHQALGFEE-
1vhsA           LXAFGHNKPSLKLFEKHGFAE-
2a6aA2          IVLKDDISPAVLVEESERLFR-
2b3uA1          XHFLVANEPSINFYKRRGASD-
2fiaA1          MYAQHTNHRMIRFFESKGFTK-
2ozgA2          SVL---YPATQRLYRKAGYEQ-
2bswA1          LWCNA-RTSASGYYKKLGFSE-
1wwzA1          LWVGEKNYGAMNLYEKFGFKK-
1gheA           LHLDTEGSVAEAFYSALAYTR-
2ganA1          PNLEAYS----YYYXKKGFR--
1yreA1          VQLSASNLRAQGAIDKLGAQR-
1y7rA1          VSLIA-DYPADKLYVKFGF---
2i6cA1          XKISCFNAAGLLLYTQLGYQ--
1wk4A           LVWLKENPKGRGFYEHLGGVL-
1s7fA1          FVIKCRVDASNAVARRNHFTL-
2g3aA1          AYIDTXNPDALRTYERYGFTK-
1m44A           ARRLYASRGWLPWHGPTSVLA-
1bo4A           IYVQADDDPAVALYTKLG----
1sqhA           LTAWIVNWRSEALLKRIGYQK-
1yr0A1          LIAAAENTASIRLHESLGFR--
1q2yA           FILNA-QTQAVPFYKKHGYR--