[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for cper0:BAB80292.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1poiB.bssp"
#ERROR : Can't open dsspfile "2ahuA1.bssp"
#ERROR : Can't open dsspfile "1ks2A1.bssp"
#ERROR : Can't open dsspfile "1t5oA.bssp"
#ERROR : Can't open dsspfile "2ahuA2.bssp"
#ERROR : Can't open dsspfile "1m3eA2.bssp"
#ERROR : Can't open dsspfile "1vb5A.bssp"
#ERROR : Can't open dsspfile "1ucrA.bssp"
#ERROR : Can't open dsspfile "2g39A1.bssp"
#ERROR : Can't open dsspfile "1lvaA4.bssp"
#ERROR : Can't open dsspfile "2r5fA1.bssp"
#ERROR : Can't open dsspfile "1v4rA1.bssp"
#ERROR : Can't open dsspfile "2hs5A1.bssp"
#ERROR : Can't open dsspfile "1ft9A1.bssp"
#ERROR : Can't open dsspfile "1hlvA1.bssp"
#ERROR : Can't open dsspfile "2gnpA1.bssp"

## Summary of PDB Search
:248
    1e-26  14%  1poiB  [c.124.1.3] GLUTACONATE COENZYME A-TRANSFERASE
    8e-25  10%  2ahuA1 [c.124.1.3] PUTATIVE ENZYME YDIF A:283 -- 529
    1e-23  20%  1ks2A1 [c.124.1.4] PROTEIN EC1268, RPIA A:2 -- 126 A:199 -- 219
    1e-23  21%  1t5oA  [c.124.1.5] TRANSLATION INITIATION FACTOR EIF2B, SUBUNIT
    1e-20  11%  2ahuA2 [c.124.1.2] PUTATIVE ENZYME YDIF A:4 -- 276
    5e-16  15%  1m3eA2 [c.124.1.3] SUCCINYL-COA:3-KETOACID-COENZYME A TRANSFERASE
    5e-13  26%  1vb5A  [c.124.1.5] TRANSLATION INITIATION FACTOR EIF-2B
    4e-09  15%  1ucrA  [a.4.5.45] PROTEIN DSVD
    2e-08  17%  2g39A1 [c.124.1.2] ACETYL-COA HYDROLASE A:3 -- 223
    2e-06  14%  1lvaA4 [a.4.5.35] SELENOCYSTEINE-SPECIFIC ELONGATION FACTOR A:575
    2e-04  20%  2r5fA1 [c.124.1.8] TRANSCRIPTIONAL REGULATOR, PUTATIVE A:59 -- 316
    2e-04  14%  1v4rA1 [a.4.5.6] TRANSCRIPTIONAL REPRESSOR A:1 -- 100
    4e-04  11%  2hs5A1 [a.4.5.6] PUTATIVE TRANSCRIPTIONAL REGULATOR GNTR A:25 --
    5e-04   8%  1ft9A1 [a.4.5.4] CARBON MONOXIDE OXIDATION SYSTEM TRANSCRIPTION
    5e-04  12%  1hlvA1 [a.4.1.7] MAJOR CENTROMERE AUTOANTIGEN B A:1 -- 66
    6e-04  24%  2gnpA1 [c.124.1.8] TRANSCRIPTIONAL REGULATOR A:56 -- 317
:248

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MLSEKRHEIILNLLKLKGFVXXXXXXXXXXXXXXXIRRDLSYLESINLLKRVHGGAKSLANVSKELSYNE
1poiB           ----------------------------------------------------------------------
2ahuA1          ----------------------------------------------------------------------
1ks2A1          ----------------------------------------------------------------------
1t5oA           ----------------------------------------------VGIERALNAALKGESVEKELALRE
2ahuA2          ---------------------------------------------------------------------K
1m3eA2          ----------------------------------------------------------------------
1vb5A           -------------------------------------------------------MASLYNLARFIPVTN
1ucrA           -----------------------------------------------AKQKVVDFLNSKSGSKSKFYFND
2g39A1          ----------------------------------------------------------------------
1lvaA4          -----EAREVIKNLASTGPFGLAEARDALGSSRKYVLPLLEYLDQVKFTRRVGDKR--------------
2r5fA1          ----------------------------------------------------------------------
1v4rA1          -----------------------------------VSRALAVLKSEGLVSSRGALGTVVEKNPIVITGAD
2hs5A1          VAGILRDAIIDGTFRPGARLSEPDICAALDVSRNTVREAFQILIEDRLVAHELNR---------------
1ft9A1          FIDHANTTGRQTGVIVSVDFTVEEIANLIGSSRQTTSTALNSLIKEGYISRQGRGHYTIPNLVRL-----
1hlvA1          QLTFREKSRIIQEVEENPDLRKGEIARRFNIPPSTLSTILKNKRAILASERKYGVAS-------------
2gnpA1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           KSSKSIHEKRAIAKYAASLIEDGDCIFVDAGTTTYELIDYLEGKDILVVSNGLSHIDTLIQKNIKCYVIG
1poiB           -----YTNKEMQAVTIAKQIKNGQVVTVGTGLPLIGASVAKRVPDCHIIVESGLMDCSPEVPRSVGDLRF
2ahuA1          -----LNQRKLVARRALFEXRKGAVGNVGVGIADGIGLVAREEGCADDFI-------LTVETGPIGGITS
1ks2A1          -------LKKAVGWAALQYVQPGTIVGVGTGSTAAHFIDALKGQIEGAVSSSDASTEKLKSLGI------
1t5oA           AAEEDVERNRKMGEYGAELLEDGDVVLTYCNAGRLATVDWGQGKEIRVIACETRPLNQGSRLTCWELME-
2ahuA2          PPRINGRVPVLSAQEAVNYIPDEATLCVLGAGGGILEATTLDKYKQTQTPRNLSIISPTGLRGISPLAQE
1m3eA2          -------VRERIIKRAALEFEDGXYANLGIGIPLLASNFISPNXTVHLQSENGILGPYPLQNEVDADLIN
1vb5A           RRDILKSRKRELASIGAQLIDDGDVIITHSFSSTVLEIIRTRKKRFKVIYEGLHLARELEFSGIEFEVI-
1ucrA           TDLFPDMKQREVKKILTALVNDEVLEYWSSGSTTMYGLKGAGKQ--------------------------
2g39A1          ---PSLLDKVXSAAEAADLIQDGXTVFTRAGEAK-AVPQALAKERPLRISLGNDLDKQLTEARRXPFQVD
1lvaA4          ----------------------------------------------------------------------
2r5fA1          --------GSAAAHYLETSLSAQDHIGISSWSSTIRAXVSHPGKQSAQE---------------------
1v4rA1          R--LKRMEKNGMRYAPG-----------------------------------------------------
2hs5A1          ----------------------------------------------------------------------
1ft9A1          ----------------------------------------------------------------------
1hlvA1          ----------------------------------------------------------------------
2gnpA1          ---------QVAAGVLRNLIDDNXKIGFSWGKSLSNLVDLISVRNVHFYPGGPSHIHAKYHVNTLIY---


                         +         .         .         .         .         *         .:210
query           GNIKISTKAITGCDALMCLSKFRFDKCFIGANGVHHTYGLTTPDTEEAILKECAINNSRKAYVLADDSKF
1poiB           MAHCGPNVRFVGFEINEYLHKANRLIAFIGGAQIDPYGNVNSTSIGDYHHPKTRFTGSGGANGIATYSNT
2ahuA1          GANVNTRAILDXTSQFDFYHGGGLDVCYLSFAEVDQHGNVGVHKFNGTGGFIDISATSKKIIFCGTLTAG
1ks2A1          -------------HVFDLNEVDSLGIYVDGADEINGHXQXIKGGGAALTREKIIASVAEKFICIADASKQ
1t5oA           --DGIDVTLITDSMVGIVMQKGMVDKVIVGADRIVRDAVFN--KIGTYTVSVVAKHHNIPFYVAAPKATF
2ahuA2          GLVKWALCGHWGQSPRISDEQNKIIAYNYPQGVLTQTLRAAAAHQPGIISDIGIGTFVDPRQQGGKLNEV
1m3eA2          AGKETVTSYFSSDESFAXIRGGHVNLTXLGAXQVSKYGDLA-----------------------------
1vb5A           ------------TDAQMGLFCREASIAIVGADMITKDGYVVNK-AGTYLLALACHENAIPFYVAAETYKF
1ucrA           ----------------------------------------------------------------------
2g39A1          STLRKAINAFIDQHLSETVEQLRPDIAVIEAAAITEQGHIVPTTSVGNSAS--FAIFAKQVIVEINLAH-
1lvaA4          ----------------------------------------------------------------------
2r5fA1          ----------------------------------------------------------------------
1v4rA1          ----------------------------------------------------------------------
2hs5A1          ----------------------------------------------------------------------
1ft9A1          ----------------------------------------------------------------------
1hlvA1          ----------------------------------------------------------------------
2gnpA1          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           GEISTIKFSDINKCVIITNEKPKDNTxxxxxxxxxxxx
1poiB           IIMMQHEKRRMNKIDYVT--------------------
2ahuA1          SLKTEIADGKLNIVKFIRELPEITF-------------
1ks2A1          VDILANRGADVA--LIGTPDGVKTIV------------
1t5oA           DWERTAKDVVIEER------------------------
2ahuA2          TKEDLIKLVEFD--------------------------
1m3eA2          --------------------------------------
1vb5A           --------------------------------------
1ucrA           --------------------------------------
2g39A1          -STNLEGLHDI---------------------------
1lvaA4          --------------------------------------
2r5fA1          --------------------------------------
1v4rA1          --------------------------------------
2hs5A1          --------------------------------------
1ft9A1          --------------------------------------
1hlvA1          --------------------------------------
2gnpA1          --------------------------------------