[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for cper0:BAB80582.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1yk3A1.bssp"
#ERROR : Can't open dsspfile "1s3zA.bssp"
#ERROR : Can't open dsspfile "1vhsA.bssp"
#ERROR : Can't open dsspfile "1z4eA1.bssp"
#ERROR : Can't open dsspfile "1m44A.bssp"
#ERROR : Can't open dsspfile "1gheA.bssp"
#ERROR : Can't open dsspfile "1bo4A.bssp"
#ERROR : Can't open dsspfile "1mk4A.bssp"
#ERROR : Can't open dsspfile "2ge3A1.bssp"
#ERROR : Can't open dsspfile "2fsrA1.bssp"
#ERROR : Can't open dsspfile "1qsmA.bssp"
#ERROR : Can't open dsspfile "2b3uA1.bssp"
#ERROR : Can't open dsspfile "1y9wA1.bssp"
#ERROR : Can't open dsspfile "1b6bA.bssp"
#ERROR : Can't open dsspfile "2fiaA1.bssp"
#ERROR : Can't open dsspfile "1on0A.bssp"
#ERROR : Can't open dsspfile "1tiqA.bssp"
#ERROR : Can't open dsspfile "1xebA.bssp"
#ERROR : Can't open dsspfile "2fiwA1.bssp"
#ERROR : Can't open dsspfile "2fl4A1.bssp"
#ERROR : Can't open dsspfile "1bobA.bssp"
#ERROR : Can't open dsspfile "1vkcA.bssp"
#ERROR : Can't open dsspfile "1yr0A1.bssp"
#ERROR : Can't open dsspfile "1s7fA1.bssp"
#ERROR : Can't open dsspfile "1i12A.bssp"
#ERROR : Can't open dsspfile "1nslA.bssp"
#ERROR : Can't open dsspfile "1xmtA.bssp"
#ERROR : Can't open dsspfile "2ozgA2.bssp"
#ERROR : Can't open dsspfile "1u6mA.bssp"
#ERROR : Can't open dsspfile "1cm0A.bssp"
#ERROR : Can't open dsspfile "2bswA1.bssp"
#ERROR : Can't open dsspfile "1ro5A.bssp"
#ERROR : Can't open dsspfile "1y9kA1.bssp"
#ERROR : Can't open dsspfile "1yx0A1.bssp"
#ERROR : Can't open dsspfile "1ozpA.bssp"
#ERROR : Can't open dsspfile "1wwzA1.bssp"
#ERROR : Can't open dsspfile "2atrA1.bssp"
#ERROR : Can't open dsspfile "2a6aA2.bssp"
#ERROR : Can't open dsspfile "2i00A2.bssp"
#ERROR : Can't open dsspfile "1y7rA1.bssp"
#ERROR : Can't open dsspfile "1b87A.bssp"
#ERROR : Can't open dsspfile "1yreA1.bssp"
#ERROR : Can't open dsspfile "2ae6A1.bssp"
#ERROR : Can't open dsspfile "2ganA1.bssp"
#ERROR : Can't open dsspfile "1lrzA3.bssp"
#ERROR : Can't open dsspfile "2euiA1.bssp"
#ERROR : Can't open dsspfile "2g3aA1.bssp"
#ERROR : Can't open dsspfile "2i6cA1.bssp"
#ERROR : Can't open dsspfile "1q2yA.bssp"
#ERROR : Can't open dsspfile "1wk4A.bssp"
#ERROR : Can't open dsspfile "1sqhA.bssp"
#ERROR : Can't open dsspfile "2hv2A2.bssp"

## Summary of PDB Search
:147
    1e-12  15%  1yk3A1 [d.108.1.1] HYPOTHETICAL PROTEIN RV1347C/MT1389 A:10 -- 207
    2e-11  18%  1s3zA  [d.108.1.1] AMINOGLYCOSIDE 6'-N-ACETYLTRANSFERASE
    3e-11  14%  1vhsA  [d.108.1.1] SIMILAR TO PHOSPHINOTHRICIN ACETYLTRANSFERASE
    3e-11  17%  1z4eA1 [d.108.1.1] TRANSCRIPTIONAL REGULATOR A:4 -- 153
    3e-11  11%  1m44A  [d.108.1.1] AMINOGLYCOSIDE 2'-N-ACETYLTRANSFERASE
    3e-11  19%  1gheA  [d.108.1.1] ACETYLTRANSFERASE
    3e-11  13%  1bo4A  [d.108.1.1] PROTEIN (SERRATIA MARCESCENS AMINOGLYCOSIDE-3-N-
    6e-11  15%  1mk4A  [d.108.1.1] HYPOTHETICAL PROTEIN YQJY
    7e-11  14%  2ge3A1 [d.108.1.1] PROBABLE ACETYLTRANSFERASE A:6 -- 169
    1e-10  14%  2fsrA1 [d.108.1.1] ACETYLTRANFERASE A:4 -- 167
    2e-10  23%  1qsmA  [d.108.1.1] HPA2 HISTONE ACETYLTRANSFERASE
    2e-10  16%  2b3uA1 [d.108.1.1] DIAMINE ACETYLTRANSFERASE 1 A:2 -- 170
    2e-10  29%  1y9wA1 [d.108.1.1] ACETYLTRANSFERASE A:1 -- 140
    2e-10  17%  1b6bA  [d.108.1.1] PROTEIN (ARYLALKYLAMINE N-ACETYLTRANSFERASE)
    4e-10  15%  2fiaA1 [d.108.1.1] ACETYLTRANSFERASE A:1 -- 157
    4e-10  21%  1on0A  [d.108.1.1] YYCN PROTEIN
    5e-10  22%  1tiqA  [d.108.1.1] PROTEASE SYNTHASE AND SPORULATION NEGATIVE
    5e-10  11%  1xebA  [d.108.1.1] HYPOTHETICAL PROTEIN PA0115
    1e-09  25%  2fiwA1 [d.108.1.1] GCN5-RELATED N- A:2 -- 157
    2e-09  17%  2fl4A1 [d.108.1.1] SPERMINE/SPERMIDINE ACETYLTRANSFERASE A:1 -- 146
    3e-09  13%  1bobA  [d.108.1.1] HISTONE ACETYLTRANSFERASE
    3e-09  24%  1vkcA  [d.108.1.1] PUTATIVE ACETYL TRANSFERASE
    4e-09  23%  1yr0A1 [d.108.1.1] PHOSPHINOTHRICIN ACETYLTRANSFERASE A:4 -- 166
    7e-09  11%  1s7fA1 [d.108.1.1] ACETYL TRANSFERASE A:1 -- 176
    8e-09  19%  1i12A  [d.108.1.1] GLUCOSAMINE-PHOSPHATE N-ACETYLTRANSFERASE
    9e-09  13%  1nslA  [d.108.1.1] PROBABLE ACETYLTRANSFERASE
    2e-08  11%  1xmtA  [d.108.1.1] PUTATIVE ACETYLTRANSFERASE
    2e-08  12%  2ozgA2 [d.108.1.10] GCN5-RELATED N-ACETYLTRANSFERASE A:8 -- 290
    2e-08  13%  1u6mA  [d.108.1.1] ACETYLTRANSFERASE, GNAT FAMILY
    5e-08  21%  1cm0A  [d.108.1.1] P300/CBP ASSOCIATING FACTOR
    1e-07  12%  2bswA1 [d.108.1.1] GLYPHOSATE N-ACETYLTRANSFERASE A:2 -- 146
    1e-07  15%  1ro5A  [d.108.1.3] AUTOINDUCER SYNTHESIS PROTEIN LASI
    1e-07  28%  1y9kA1 [d.108.1.1] IAA ACETYLTRANSFERASE A:1 -- 152
    2e-07  19%  1yx0A1 [d.108.1.1] HYPOTHETICAL PROTEIN YSNE A:1 -- 151
    4e-07  12%  1ozpA  [d.108.1.1] HYPOTHETICAL PROTEIN RV0819
    4e-07  23%  1wwzA1 [d.108.1.1] HYPOTHETICAL PROTEIN PH1933 A:1 -- 157
    5e-07  21%  2atrA1 [d.108.1.1] ACETYLTRANSFERASE, GNAT FAMILY A:1 -- 137
    6e-07  10%  2a6aA2 [c.55.1.9] HYPOTHETICAL PROTEIN TM0874 A:104 -- 193
    6e-07  10%  2i00A2 [d.108.1.10] ACETYLTRANSFERASE, GNAT FAMILY A:10 -- 300
    9e-07  23%  1y7rA1 [d.108.1.1] HYPOTHETICAL PROTEIN SA2161 A:1 -- 133
    1e-06  14%  1b87A  [d.108.1.1] PROTEIN (AMINOGLYCOSIDE N6'-ACETYLTRANSFERASE
    2e-06  10%  1yreA1 [d.108.1.1] HYPOTHETICAL PROTEIN PA3270 A:11 -- 193
    2e-06  18%  2ae6A1 [d.108.1.1] ACETYLTRANSFERASE, GNAT FAMILY A:1 -- 161
    2e-06  27%  2ganA1 [d.108.1.1] 182AA LONG HYPOTHETICAL PROTEIN A:1 -- 182
    3e-06   9%  1lrzA3 [d.108.1.4] FACTOR ESSENTIAL FOR EXPRESSION OF METHICILLIN
    3e-06  17%  2euiA1 [d.108.1.1] PROBABLE ACETYLTRANSFERASE A:1 -- 153
    6e-06  20%  2g3aA1 [d.108.1.1] ACETYLTRANSFERASE A:1 -- 137
    9e-06  18%  2i6cA1 [d.108.1.1] PUTATIVE ACETYLTRANSFERASE A:1001 -- 1160
    2e-05  26%  1q2yA  [d.108.1.1] SIMILAR TO HYPOTHETICAL PROTEINS
    2e-05  19%  1wk4A  [d.108.1.1] TTK003001606
    4e-05  17%  1sqhA  [d.108.1.5] HYPOTHETICAL PROTEIN CG14615-PA
    9e-05  15%  2hv2A2 [d.108.1.10] HYPOTHETICAL PROTEIN A:2 -- 286
:147

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MSNIYEFKKEDLNECAELFVKTFSKEPWNEPWDFENAKKRLNDVVLTPGFRGAVLRNDEKIEGVILGNLE
1yk3A1          ---LRVAQLTDAEMLAEWMNRPHLAAAWEYDWPASRWRQHLNAQLEGTYSLPLIGSWHGTDGGYLELYWA
1s3zA           ---IRQMNKTHLEHWRGLRKQLWPGHPD--DAHLADGEEILQA----DHLASFIAMADGVAIGFADASIR
1vhsA           ---LRLAEHRDLEAVVAIYNSTIASRADTEPVTPEDRXEWFSGHTESRPLYVAEDENGNVAAWISFETFY
1z4eA1          ---IREATEGDLEQMVHMLADDVLGRERYEKPLPVSYVRAFKEIKKDKNNELIVACNGEEIVGMLQVTFT
1m44A           -----DLDSETRQDIRQMVTGAFA-----GDFTETDWEHTLGGMHALIWHHGAIIAHAAVIQRRLIYR--
1gheA           ---LRRVTAESFAHYRHGLAQLLFETVHGGASQAYAWCDGLKADIAAGSLLLWVVAEDDNVLASAQLSLC
1bo4A           IIRTCRLGPDQVKSMRAALDLFGREFGDVATYQHQPDSDYLGNLLRSKTFIALAAFDQEAVVGALAAYVK
1mk4A           --DIRTITSSDYEMVTSVL-----NEWWGGRQLKEKLPRLFFE---HFQDTSFITSEHNSMTGFLIGFQS
2ge3A1          ---IKPIRAEHVESFHRALDAVSRERLSFLEAPPLEAVRAFVLDXIENDHPQFVAIADGDVIGWCDIRRQ
2fsrA1          ------LAXADFPAYRDFXASPRSTG-VGGPYDLPSTWGVFCHDLANWHFFGHDLGETGECIGQIGIN--
1qsmA           ---VRFVTENDKEGWQRLWKSYQDFYEVSFPDDLDDFFGRFLDPNIKMWAAVAVESSSEKIIGMINFFNH
2b3uA1          ---IRPATAADCSDILRLIKELAQVILTEKLLEDGFGEHPFYHCLVAEVPKEHWTPEGHSIVGFAYYFTY
1y9wA1          ---------------------------------IQYNMSILTDEVKQPMEEVSLVVKNE--EGKIFGGVT
1b6bA           ---FRCLTPEDAAGVFEIEREAFISVSGNCPLNLDEVQHFLT----LCPELSLGWFVEGRLVAFIIGSLW
2fiaA1          --KIRVADEKELPMILQFLTEVKAYMDVVGITQWTKDYPSQGDIQEDTKKRLYLLVHEEMIFSMAT--FC
1on0A           ---------EEFRSYLTYTTKHYAEEKVKAGWLPEDAQLLLPRGLETPHHHLWSLKNEKDIVGWLWIHAE
1tiqA           -----KCSREDLQTLQQLSIETFNDTFKEQNSESAFNTEQLEKELSNXSSQFFFIYFDHEIAGYVKVNID
1xebA           ---HADLTLKELYALLQLRTEVF---VVEQKCPYQEVDGLDLV----GDTHHLXAWRDGQLLAYL-RLLD
2fiwA1          ------------------------------------------------------------LQGVPVGFAS
2fl4A1          ---FEKVTSDNRKAVENLQVFAEQQAFIESMAE------NLKESDQFPEWESAGIYDGNQLIGYAMYG--
1bobA           EFVVYKSSLVDDFARRMHR-----RVQIFSLLFIEAANYIDETDPSWQIYWLLNKKTKELIGFVTTYKYW
1vkcA           ----------------------------------------------------ALNERSELLGHVWICITL
1yr0A1          --ELRDATVDDLSGIXEIYVVNTTAIWNEVVVDLENRKDWF-AARTSRGFPVIVAILDGKVAGYASYGDW
1s7fA1          ---LRAADESHVPALHQLVLKNKAWLQQSLDWETRKHVQGNILLHQRGYAKMYLIFCQNEMAGVLSFNAI
1i12A           ---IRRMEEGDLEQVTETLKVLTTVGTITPESYWNEATVWNDKKIMQYNPMVIVDKRTETVAATGNIIIE
1nslA           ---IRLLEPKDAERLAELIIQNQQRLGKWLFFYRETIIPDWRRQYADLNGIEAGLLYDGSLCGXISLHNL
1xmtA           ------------------------------------------------------------EDHEAFIEYK
2ozgA2          --KYTKASQENIQQLGNILEQCFVXSFGDSEIYVKGI----------GLENFRVIYREQKVAGGLAILPX
1u6mA           ------VSEEQMIDLLAEATAYPTYRYGYQRILAGIAVGYPAEDEKIIDEPLREVFKKHGLAEDVRLFIE
1cm0A           ---------MWLVGLQNVFSHQLPRMP----------KEYITRLVFDPKHKTLALIKDGRVIGGIC--FR
2bswA1          --EVKPINAEDTYELRHRILRPNQPIEACXFESDLL-----------RGAFHLGGYYGGKLISIASFEHS
1ro5A           ---REEFDKKLLGEMHKLRAQVFKERKGWDVSVIDEMEIDGYD---ALSPYYMLIQEDGQVFGELLHGKE
1y9kA1          -----------------------------------------------------VAKQGGSVIGVYVL-LE
1yx0A1          ----------------------------------------------------------------------
1ozpA           -------------------------GHPEQGGWTAVQLAERRGEAWFDPDGLILAFGDGRLLGFHWTKVH
1wwzA1          -------------------------------------RNYIKWCWKKASDGFFVAKVGDKIVGFIKDWFS
2atrA1          ---IKKQEIVKLEDVLHLY--------QAVGWTNEXLEQALHSLVI------YLALDGDAVVGLIRL---
2a6aA2          -------------------------------------------------------------DGVVLVAR-
2i00A2          --TLKPVEEEHIDQFNELFQVTEADIEESGFENKRAFIKSKQP--ILELSKVFGWFHENQLISYPCEVNI
1y7rA1          ------------------------------PKTREAAEKGLPNALFT-----VTLYDKDRLXGRVIGD--
1b87A           --IISEFDRNNPVLKDQLSDLLRLTWPEEYGDSSAEEVEEMMN----PERIAVAAVDQDELVGFIGAIPQ
1yreA1          ---LEPLVEADIPELVSLAEANREALQYMDGPTRPDWYRQSLAEQREGRALPLAVRLGVQLVGTT-RFAE
2ae6A1          -----------------------------------------------------VAISGQQLAGFIVHPPT
2ganA1          -----------------------------------------------------TYQKDNRIIGIALVYKR
1lrzA3          -------------------------PIFRSFMDDKFYYNRLKY--YKDRVLVPLAYINELPISAGFF---
2euiA1          ---IVQATLEHLDLLAPLFVKEFYGXLSYPESSRKFLEKRLRSVIYL-----ALADEEDRLLGQLYPSFS
2g3aA1          -------------------------------------------------------------DNSVTGGLV
2i6cA1          ---------------------------AIWPFSVA----QLAAAIAERR-GSTVAVHDGQVLGFA--NFY
1q2yA           --------EEQLKDAFYVREEVFVKEAEEEIDELENESEHI------------VVYDGEKP--VGAGRWR
1wk4A           ---IRRAGLEDLPGVARVLVDTWFLEGLSYEGQAERWAQRLKTPTWPGRLFVAESESGEVVGFAAFGPDR
1sqhA           ----------------------------------------------------------------------
2hv2A2          ---VKKXGKEEXKEXFDLVIYAFN-QEPTAERQERFEKLL-------SHTQSYGFLIDEQLTSQVXATPF


                         .         .         *         .         .         .         .:140
query           QWYDGEHFCVKEFFVDSSSQGKGTGKKLLNALEDILMEKEVGVIHFWTMKGSTAEAFYNKRGYEIPKELI
1yk3A1          ADADPYDLGLHAAIADLSKVNRGFGPLLLPRIVASVFANEPRRIMFDPDHRNTTRRLCEWAGCKFLGEHA
1s3zA           HDYSSPVVFLEGIFVLPSFRQRGVAKQLIAAVQRWGTNKGCREMASDTSPENTSQKVHQALGFEETERVI
1vhsA           GRPAYNKTAEVSIYIDEACRGKGVGSYLLQEALRIAPNLGIRSLXAFIFGHNKSLKLFEKHGFAERYDLK
1z4eA1          PYLTYQGSWRATVRTHSAARGQGIGSQLVCWAIERAKERGCHLIQLTTDKQRPALRFYEQLGFKA-----
1m44A           -GNALRCGYVEGVAVRADWRGQRLVSALLDAVEQVM--RGAYQLGALSSSARAWLPWHGPTSVLAPTGPT
1gheA           QKPNGLNRAEVQKLVLPSARGRGLGRQLXDEVEQVAVKHKRGLLHLDTEAGSVAEAFYSALAYTRLHPTA
1bo4A           FEQPRSEIYIYDLAVSGEHRRQGIATALINLLKHEANALGAYVIYVQADYGDDAVALYTKLG--------
1mk4A           -QSDPETAYIHFSGVHPDFRKMQIGKQLYDVFIETVKQRGCTRVKCVTSPVNKSIAYHTKLGFDI-----
2ge3A1          DRATRAHCGTLGXGILPAYRNKGLGARLXRRTLDAAHEFGLHRIESVHADNARAIALYEKIGFAHEGRA-
2fsrA1          -HGPLFPEKELGWLLYEGHEGRGYAAEAAVALRDWAFETLPTLVSYVSPQNRKSAAVAERIGGTLDPLA-
1qsmA           MTTWDFKIYINDLYVDENSRVKGAGGKLIQFVYDEADKLGTPSVYWCTDESNHAQLLYVKVGYKAPKIL-
2b3uA1          DPWIGKLLYLEDFFVXSDYRGFGIGSEILKNLSQVAXRCRCSSXHFLVAEWNESINFYKRRGASD-----
1y9wA1          GTMYFYHLHIDFLWVDESVRHDGYGSQLLHEIEGIAKEKGCRLILLDSF-SFQAPEFYKKHGYR------
1b6bA           DEERGHSAHLHALAVHRSFRQQGKGSVLLWRYLHHVGAQP-AVRRAVLMCEDALVPFYQRFGFH------
2fiaA1          MEQEQDFVWLKRFATSPNYIAKGYGSLLFHELEKRAVWEGRRKMYAQTNHTNHMIRFFESKGFTKIHESY
1on0A           PEHPQQEAFIYDFGLYEPYRGKGYAKQALAALDQAARSXGIRKLSLHVFAHNQARKLYEQTGFQ--ETDV
1tiqA           DAQGAESLEIERIYIKNSFQKHGLGKHLLNKAIEIALERNKKNIWLGVWEKNEAIAFYKKXGFVQTGAH-
1xebA           PVRHEGQVVIGRVVSSSAARGQGLGHQLXERALQAAERL--WLDTPVYLSAQALQAYYGRYGFVA-----
2fiwA1          LKGPDH---IDXLYVHPDYVGRDVGTTLIDALEKLAGARGALI---LTVDASNAAEFFAKRGYVAKQR--
2fl4A1          -RWQDGRVWLDRFLIDQRFQGQGYGKAACRLLMLKLIEKQTNKLYLSVYDTNSAIRLYQQLGFVFNGELM
1bobA           HYIDKKFRAISQFLIFPPYQNKGHGSCLYEAIIQSWLEDKSITEITVEDPNEAFDDLRDRNDIQRLRKL-
1vkcA           DTVDYVKIAIYDIEVVKWARGLGIGSALLRKAEEWAKERGAKKIVLRVEIDNPAVKWYEERGYK-ARALI
1yr0A1          RAFDGRHTREHSVYVHKDARGHGIGKRLXQALIDHAGGNDVHVLIAAIEAENTASRLHESLGFRV-----
1s7fA1          EPIN--KAAYIGYWLDESFQGQGIMSQSLQALMTHYARRIRRFVIKCRVDNQASNAVARRNHFTLYHDVN
1i12A           RKILGLCGHIEDIAVNSKYQGQGLGKLLIDQLVTIGFDYGCYKIILDCD--EKNVKFYEKCGFSNAGVEM
1nslA           DQVN--RKAEIGYWIAKEFEGKGIITAACRKLITYAFEELNRVAICAAVGNEKSRAVPERIGFLEEGKAV
1xmtA           MRNNGKVMDLVHTYVPSFKRGLGLASHLCVAAFEHASSHSISIIPTFLPRNPSWKPLIHSEVF-------
2ozgA2          GQWWGGQRVIAAVGIAPEYRGDGAAIALIQHTLQEISEQDIPISVLYPA----TQRLYRKAGYEQAGSSC
1u6mA           EETLPNEWYLDTISVDERFRGMGIGSKLLDALPEVAKASGKQALGLNVDFDNPARKLYASKGFKDVTTMN
1cm0A           MFPSQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYH--IKHDILNFLTYADEYAIGYFKKQGFSK-----
2bswA1          ELQGQKQYQLRGXATLEGYREQKAGSSLIKHAEEILRKRGADLLWCNARTS--ASGYYKKLGFSE-----
1ro5A           APCSPHIWELSRFAINSGQKGSLGFSDCTLEAMRALARYSQNDIQTLVTVTTVVEKMMIRAGLDVSRFGV
1y9kA1          TRPKTXE--IXNIAVAEHLQGKGIGKKLLRHAVETAKGYGXSKLEVGTGNSSVQLALYQKCGFRI-----
1yx0A1          -ELDTRHGEIKSMRTSASHLRKGVAKQVLQHIIEEAEKRGYERLSLETGSMASARKLYESFGFQ------
1ozpA           PDHPG-LGEVYVLGVDPAAQRRGLGQMLTSIGIVSLARRLEPAVLLYVESDNVAVRTYQSLGFTTYSVD-
1wwzA1          KYEGRIVGAIHEFVVDKKFQGKGIGRKLLITCLDFLGKYNDTIELWVGEKNYGAMNLYEKFGFKSGIWVR
2atrA1          VGDGFSSVFVQDLIVLPSYQRQGIGSSLXKEALGNF--KEAYQVQLATEETEKNVGFYRSXGFEI-----
2a6aA2          -RARKGYHYCAVYLKDKGLNPLKEPSVVSDEELEEITKEFSPKIVLKDDLLISAVLVEESERLFREKKTL
2i00A2          HGALYKMGGVTGVGTYPEYANHGLMKDLIQTALEEMRQDKQWISYLFP----YNIPYYRRKGWE------
1y7rA1          ---GGTVFQIVDIAVLKSYQGQAYGSLIXEHIXKYIKNVSVESVYVSLIADYPADKLYVKFGF-------
1b87A           YGITGWE--LHPLVVESSRRKNQIGTRLVNYLEKEVASRGGITIYLGTDDLDHGTLSQTDLYEHTFDKVA
1yreA1          FLPALPACEIGWTWLDQAQHGSGLNRMIKYLMLKHAFDNLRRVQLSTAASNLRAQGAIDKLGAQR-----
2ae6A1          SLAAHQKQWLLSIGVSPDFQDQGIGGSLLSYIKDXAEISGIHKLSLRVXATNQAIRFYEKHGFVQ-----
2ganA1          IKEKGIWWVPEEFVVDPEFQGKGIGSTLLEFAVKRL--RSLGDPYVVTFPNLAYSYYYXKKGFREYKEFV
1lrzA3          -FINPFEVVYYAGGTSNAFRHFAGSYAVQWEMINYALNHGIDRYNFYGVSGAGVVKFKKGYNAEI-----
2euiA1          SLSLKRVWILNDIYVAEEARRQLVADHLLQHAKQXARETHAVRXRVSTSVDNVAQKVYESIGFREDQEFK
2g3aA1          GHTARGWLYVQLLFVPEAXRGQGIAPKLLAXAEEEARKRGCXGAYIDT-XNPDALRTYERYGFTKIGSLT
2i6cA1          QWQHGDFCALGNXXVAPAARGLGVARYLIGVXENLAREQKARLXKISCFANAAGLLLYTQLGYQ------
1q2yA           M--KDGYGKLERICVLKSHRSAGVGGIIMKALEKAA--ADGGASGFILNAQTQAVPFYKKHGYRV-----
1wk4A           ASGFPGYTALWAIYVLPTWQRKGLGRALFHEGARLLAEGYGRXLVWVLKENPKGRGFYEHLGGVL-----
1sqhA           -IFQNDFSGLGXLQVLPKAERRGLGGLLAAAXSREIARGEEITLTAWIVATNWSEALLKRIGYQK-----
2hv2A2          QVNFHGVRYIGYVASYPEYRGEGGISAIXKEXLADLAKQKVALSYLAP----FSYPFYRQYGYEQTFEQA


                         +         .         .         .         .         *         .:210
query           MMRKKLK
1yk3A1          LYALEA-
1s3zA           FYRKR--
1vhsA           ILGREL-
1z4eA1          -------
1m44A           VFVLPI-
1gheA           IYFKTL-
1bo4A           -------
1mk4A           -------
2ge3A1          -------
2fsrA1          -------
1qsmA           -------
2b3uA1          -------
1y9wA1          -------
1b6bA           -------
2fiaA1          LYVKELE
1on0A           VXSKKL-
1tiqA           -------
1xebA           -------
2fiwA1          -------
2fl4A1          EWTHQ--
1bobA           -------
1vkcA           M------
1yr0A1          -------
1s7fA1          MYARII-
1i12A           QIRK---
1nslA           YYSLLKR
1xmtA           -------
2ozgA2          VWEIP--
1u6mA           HMQKEVE
1cm0A           -------
2bswA1          -------
1ro5A           ALRIELN
1y9kA1          -------
1yx0A1          -------
1ozpA           -------
1wwzA1          MIKRQ--
2atrA1          -------
2a6aA2          YLQK---
2i00A2          -------
1y7rA1          -------
1b87A           SIQ----
1yreA1          -------
2ae6A1          -------
2ganA1          ILKFNHK
1lrzA3          -------
2euiA1          NYTLPIS
2g3aA1          WLEKRF-
2i6cA1          -------
1q2yA           -------
1wk4A           -------
1sqhA           -------
2hv2A2          EYTIK--