[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for cper0:BAB80734.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1o51A.bssp"

## Summary of PDB Search
:113
    3e-11  34%  1o51A  [d.58.5.4] HYPOTHETICAL PROTEIN TM0021
:113

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxFLKIFIDESDKYNGEPLYLEILKVLKKENILGATVIRGIEGLDSHHKIHSDFIEILARxxxx
1o51A           --------LLKIYLGEKDKHSGKPLFEYLVKRAYELGXKGVTVYRGIXGFGHPDLPI--VLEIVDE----


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1o51A           -------------------------------------------