[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for cper0:BAB81009.1

[Show Plain Result]

#ERROR : Can't open dsspfile "13pkA.bssp"
#ERROR : Can't open dsspfile "1k8tA.bssp"
#ERROR : Can't open dsspfile "1zczA2.bssp"
#ERROR : Can't open dsspfile "1puzA.bssp"
#ERROR : Can't open dsspfile "1ymyA2.bssp"
#ERROR : Can't open dsspfile "1ywuA1.bssp"
#ERROR : Can't open dsspfile "1v8hA1.bssp"
#ERROR : Can't open dsspfile "1umgA.bssp"

## Summary of PDB Search
:397
    e-153  51%  13pkA  [c.86.1.1] 3-PHOSPHOGLYCERATE KINASE
    8e-69  12%  1k8tA  [e.41.1.1] CALMODULIN-SENSITIVE ADENYLATE CYCLASE
    6e-44  20%  1zczA2 [c.97.1.4] BIFUNCTIONAL PURINE BIOSYNTHESIS PROTEIN PURH
    3e-20  22%  1puzA  [a.218.1.1] CONSERVED HYPOTHETICAL PROTEIN
    2e-14  14%  1ymyA2 [c.1.9.10] N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE A:54
    2e-08  16%  1ywuA1 [b.45.2.1] HYPOTHETICAL PROTEIN PA4608 A:1 -- 125
    4e-06  10%  1v8hA1 [b.1.18.19] SULFUR OXIDATION PROTEIN SOXZ A:2 -- 107
    4e-04  32%  1umgA  [d.280.1.1] 385AA LONG CONSERVED HYPOTHETICAL PROTEIN
:397

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxKKTIEDVQVKGKKVLVRCDFNVPLKDGVITDENRLNGAMPTIKYLVDNGAKVILCSHMGKPKGEAK
13pkA           ----KKSINECDLKGKKVLIRVDFNVPVKNGKITNDYRIRSALPTLKKVLTEGGSCVLMSHLGRPKGIPQ
1k8tA           ------------LKGEKALKASGLVPEHADKKIARELNTYPVNKLATNLIKSGVATKGLNVHGKSSDWGP
1zczA2          ----------------------------------------------------------------------
1puzA           ----------------------------------------------------------------------
1ymyA2          ------------------NEKSGCTNYLPTLITTSDELMKQGVRVMREYLAKHPNQALGLHLEGPWLNLV
1ywuA1          -----------QHDERRRFHRIAFDADSE---ILQGERRWEV--LLHDVSLHGILVGQPQDWNGDPQRPF
1v8hA1          ----------------------------------------------------------------------
1umgA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           PEFSLAPVAKRLSEMLGKEVVFAADDNVVGENAKKAVAEMKDGDVVLLQNTRYRKEETKNGXXXXXXXXX
13pkA           QKATLKPVAKRLSELLLRPVTFAPD----CLNAADVVSKMSPGDVVLLENVRFYKEEGKDREAMAKILAS
1k8tA           QDLSKKHGQQLAVEKGNLENKKSIT--EHEGEIGKIPLKLDHLRIEEKENGIILKGKKEIKYYLLESNNQ
1zczA2          -----------------------------------------------------AFKREDLQLRYGENPHE
1puzA           ----------------------------------------------------------------------
1ymyA2          PNFVRKPDAALVDFLCENADVITKVTLAPEMVPAEVISKLNAGIVVSAGHSNATLKEAKA----------
1ywuA1          -EARLYLGLDVLIRMEI-SLAWARDGLL------------------------------------------
1v8hA1          -----------------------------RTIARLNPAKPKAGEEFRLQVVAQHPNEPGTRVEVYFEGEK
1umgA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           XXXMFVNDAFGTAHRAHCSTVGVTEYLKPAVCGYLIQKELKFLGDAVETPERPFVAILGGAKVSDKINVI
13pkA           YGDVYISDAFGTAHRDSATMTGIPKILGNGAAGYLMEKEISYFAKVLGNPPRPLVAIVGGAKVSDKIQLL
1k8tA           VYEFRISDENNEVQTKEGKITVLGEKF-NWRNIEVMAKNVEGVLKPLTAQKEWDKVVNTPNSLEKQKGVT
1zczA2          KAFVYGKPAFEILHEGKTISFN---NILDAENAWFMAKNLPRMGAVVVKHQSPCGAAIG----EDKVEIV
1puzA           ------------TRRGLLELDLIFGRFMEKEFEHLSDKELSEFSEILEFQDQELLALINGHSETDKGHLI
1ymyA2          ---GFRAGITFATHLYNAMPYI--TGREPGLAGAILDEADIYCGLHVDYANIRNAKRLKGDKLC------
1ywuA1          ----------------------------------------------------------------------
1v8hA1          VAEARPGPSTSANPLYAFKFKAEKAGTFTIK---------------------------------------
1umgA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           NNLLEKVDTLIIGGGMAYTFLKAQGYTVGSSLVEEDKVEYAKEMLAKAEEKGVKLLLPVDHRVAKEFKDV
13pkA           DNMLQRIDYLLIGGAMAYTFLKAQGYSIGKSKCEESKLEFARSLLKKAEDRKVQVILPIDHVCHTEFKAV
1k8tA           NLLIK--YGIERKPDSTKGTLSNWQKQMLDRLNEAVKYTGYTGGDVVNHGTNEI----------------
1zczA2          KKAIEADDESSFGGILAVNF--EMDEEVAKSLKKYLEVIVAPSFTQEAIEKKVRLLKPGDYASWAGKMAF
1puzA           -PMLEKIR--------------------------------------------------------------
1ymyA2          ----------------------------------------------------------------------
1ywuA1          ----------------------------------------------------------------------
1v8hA1          ----------------------------------------------------------------------
1umgA           ---------------------------AGHHIVHPDTMAAANKVLASAKEQGIILDYYITH---------


                         .         *         .         .         .         .         +:350
query           EAVVTEDQNIAEGFMGLDIGPKTEAIYAEAIKDAKTVIWNGPMGVFEFENFNKGTIAVAKAMAEADATTI
13pkA           DPLITEDQNIPEGHMALDIGPKTIEKYVQTIGKCKSAIWNGPMGVFEMVPYSKGTFAIAKAMGRGGLMSI
1k8tA           ------FIINPEGEFILTKNWEMTGRFIEKNITGKDYLYYFNRSYNKIAPGNKAYIEWTDPITKAKINTI
1zczA2          GSLVLSERKYPEG----NFELVVGEPLSEKELEDLEFAYRVV----------EGAKSNAVLIAKDGVTVG
1puzA           ----------------------------------------------------------------------
1ymyA2          ----------------------------------------------------------------------
1ywuA1          ----------------------------------------------------------------------
1v8hA1          ----------------------------------------------------------------------
1umgA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           IGGGDSAAAVNILGFGDKMSHISTGGGASLEFLEGKVLPGIAALNDK
13pkA           IGGGDSASAAELSGEAKRMSHVSTGGGASLELLEGKTLPGVTVLDDK
1k8tA           PTSAEFIKNLSSIRRSSNVVYKDSGDKD--EFAKKESVKKIAGY---
1zczA2          IGSGQPSRKRAAWIATVMAGEKAKGAVASDAFFPFPDSLEILA----
1puzA           -----------------------------------------------
1ymyA2          -----------------------------------------------
1ywuA1          -----------------------------------------------
1v8hA1          -----------------------------------------------
1umgA           -----------------------------------------------