[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for cper0:BAB81021.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1e4eA2.bssp"
#ERROR : Can't open dsspfile "1iovA2.bssp"
#ERROR : Can't open dsspfile "1ehiA2.bssp"
#ERROR : Can't open dsspfile "1vkzA3.bssp"
#ERROR : Can't open dsspfile "1ehiA1.bssp"
#ERROR : Can't open dsspfile "1gsoA3.bssp"
#ERROR : Can't open dsspfile "1cqiB2.bssp"
#ERROR : Can't open dsspfile "1eyzA3.bssp"
#ERROR : Can't open dsspfile "1bncA3.bssp"
#ERROR : Can't open dsspfile "2pbzA2.bssp"
#ERROR : Can't open dsspfile "1b6rA3.bssp"
#ERROR : Can't open dsspfile "1a9xA5.bssp"
#ERROR : Can't open dsspfile "3eeqA1.bssp"
#ERROR : Can't open dsspfile "1a9xA6.bssp"
#ERROR : Can't open dsspfile "1iovA1.bssp"
#ERROR : Can't open dsspfile "1glvA2.bssp"
#ERROR : Can't open dsspfile "1pszA.bssp"
#ERROR : Can't open dsspfile "2bjqA1.bssp"
#ERROR : Can't open dsspfile "1w93A3.bssp"
#ERROR : Can't open dsspfile "1e4eA1.bssp"
#ERROR : Can't open dsspfile "1l9aA.bssp"
#ERROR : Can't open dsspfile "1g5qA.bssp"
#ERROR : Can't open dsspfile "1ou0A.bssp"

## Summary of PDB Search
:301
    1e-44  30%  1e4eA2 [d.142.1.1] VANCOMYCIN/TEICOPLANIN A-TYPE RESISTANCE PROTEIN
    4e-31  33%  1iovA2 [d.142.1.1] D-ALA\:D-ALA LIGASE A:97 -- 306
    2e-25  33%  1ehiA2 [d.142.1.1] D-ALANINE:D-LACTATE LIGASE A:135 -- 362
    3e-25  22%  1vkzA3 [d.142.1.2] PHOSPHORIBOSYLAMINE--GLYCINE LIGASE A:94 -- 313
    3e-24  32%  1ehiA1 [c.30.1.2] D-ALANINE:D-LACTATE LIGASE A:3 -- 134
    1e-22  18%  1gsoA3 [d.142.1.2] PROTEIN (GLYCINAMIDE RIBONUCLEOTIDE SYNTHETASE)
    6e-22  10%  1cqiB2 [d.142.1.4] PROTEIN (SUCCINYL-COA SYNTHETASE BETA CHAIN) B:1
    9e-22  17%  1eyzA3 [d.142.1.2] PHOSPHORIBOSYLGLYCINAMIDE FORMYLTRANSFERASE 2
    2e-20  13%  1bncA3 [d.142.1.2] BIOTIN CARBOXYLASE A:115 -- 330
    7e-20   7%  2pbzA2 [d.142.1.9] HYPOTHETICAL PROTEIN A:100 -- 312
    1e-19  15%  1b6rA3 [d.142.1.2] PROTEIN (N5-CARBOXYAMINOIMIDAZOLE RIBONUCLEOTIDE
    8e-19  15%  1a9xA5 [d.142.1.2] CARBAMOYL PHOSPHATE SYNTHETASE (LARGE CHAIN)
    9e-19  11%  3eeqA1 [c.151.1.1] PUTATIVE COBALAMIN BIOSYNTHESIS PROTEIN G A:215
    1e-16  15%  1a9xA6 [d.142.1.2] CARBAMOYL PHOSPHATE SYNTHETASE (LARGE CHAIN)
    3e-15  39%  1iovA1 [c.30.1.2] D-ALA\:D-ALA LIGASE A:1 -- 96
    2e-14  13%  1glvA2 [d.142.1.1] GLUTATHIONE SYNTHASE A:123 -- 316
    3e-12  12%  1pszA  [c.92.2.2] PROTEIN (SURFACE ANTIGEN PSAA)
    9e-11  11%  2bjqA1 [b.169.1.1] MFP2A A:175 -- 344
    5e-10  19%  1w93A3 [d.142.1.2] ACETYL-COENZYME A CARBOXYLASE A:184 -- 450
    6e-10  42%  1e4eA1 [c.30.1.2] VANCOMYCIN/TEICOPLANIN A-TYPE RESISTANCE PROTEIN
    9e-09   8%  1l9aA  [d.201.1.1] SIGNAL RECOGNITION PARTICLE 19 KDA PROTEIN
    1e-07  10%  1g5qA  [c.34.1.1] EPIDERMIN MODIFYING ENZYME EPID
    2e-05  14%  1ou0A  [c.23.17.1] PRECORRIN-8X METHYLMUTASE RELATED PROTEIN
:301

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKVGVIMGGISSEREISIQSGNSVVHALDKDKYEAIPIVLNEKEDLIEKVKGIDFALLALHGKFGEDGTV
1e4eA2          ----------------------------------------------------------------------
1iovA2          ----------------------------------------------------------------------
1ehiA2          ----------------------------------------------------------------------
1vkzA3          ----------------------------------------------------------------------
1ehiA1          -RVALIFGGNSSEHDVSKRSAQNFYNAIEAGKYEIIVFILALEDEQPIVDADFDIFFPVVHGNLGEDGTL
1gsoA3          ----------------------------------------------------------------------
1cqiB2          ----------------------------------------------------------------------
1eyzA3          ----------------------------------------------------------------------
1bncA3          ----------------------------------------------------------------------
2pbzA2          ----------------------------------------------------------------------
1b6rA3          ----------------------------------------------------------------------
1a9xA5          ----------------------------------------------------------------------
3eeqA1          ----------------------------------------------------------------------
1a9xA6          ----------------------------------------------------------------------
1iovA1          DKIAVLLGGTSAEREVSLNSGAAVLAGLREGGIDAYPVDPKEVDVTQLKSMGFQKVFIALHGRGGEDGTL
1glvA2          ----------------------------------------------------------------------
1pszA           LENGIIFAKNIAKQLSAKDPNNKEFYEKNLKEYDKLDKLDKESKDKFNKIPAEKKLIVTSEGAFKKAYGV
2bjqA1          ----------------------------------------------------------------------
1w93A3          ----------------------------------------------------------------------
1e4eA1          IKVAILFGGCSEEHDVSVKSAIEIAANINKEKYEPLYIGLLVKKNHEYEINHVDVAFSALHGKSGEDGSI
1l9aA           ----------------------------------------------------------------------
1g5qA           -KLLICATA-----SINVININHYIVELKQHFDEVNILFSPSSKNFINTDVLKLFCDNLYDEIKDPLLNN
1ou0A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           QSVLKTLGIPFSGCGPLSSAICMDKDMTKRILAFGNVRTARWEMVSSVDEIDYEKIENLGYPVFVKPNNG
1e4eA2          -----------------------DKSLTYIVAKNAGIATPAFWVINKDDR---PVAATFTYPVFVKPARS
1iovA2          ------------------------KLRSKLLWQGAGLPVAPWVALTRAEFEKGAEISALGLPVIVKPSRE
1ehiA2          -----------------------DKALTKELLTVNGIRNTKYIVVDPESANNDKIVAELGNIVFVKAANQ
1vkzA3          ------------------------KVYAKRFXKKYGIRTARFEVAETPEELR-EKIKKFSPPYVIKADGL
1ehiA1          QGLFKLLDKPYVGAPLRGHAVS------------------------------------------------
1gsoA3          ------------------------KAFTKDFLARHKIPTAEYQNFTEVEPAL-AYLREKGAPIVIKAKGV
1cqiB2          ---------------------NLHEYQAKQLFARYGLPAPVGYACTTPREAE-EAASKIGAGPWVVKCQS
1eyzA3          -----------------------REGIRRLAAEELQLPTSTYRFADSESLFR-EAVADIGYPCIVKPVMS
1bncA3          -----------------------DKVSAIAAMKKAGVPCVPGSDGPLGDDMDKAIAKRIGYPVIIKRGMR
2pbzA2          -----------------------------------------------LQDK-ALEGAGIPRVEVVEPEDA
1b6rA3          -----------------------DRLTQKQLFDKLHLPTAPWQLLAERSEWP-AVFDRLGELAIVKRRTG
1a9xA5          -----------------------DRRRFDVAMKKIGLETARSGIAHTMEEAL-AVAADVGFPCIIRPSFT
3eeqA1          --------SIGIGSKKDVKM-EEIRDGIYKVLERLNLKRERIGIIASIREEVKKIADEFNVRFRLVNEEE
1a9xA6          ----------------------------QHAVERLKLKQPANATVTAIEMAV-EKAKEIGYPLVVRAAME
1iovA1          QGMLELMGLPYTGSGVMASALSMD----------------------------------------------
1glvA2          ----------------------------KLFTAWFSDLTPETLVTRNKAQL--KAFWEKHSDIILKPLDA
1pszA           PSAYIWEINTEEEGTPEQIKTLVEK------LRQTKVPSLFVESSVDDRPMK-TVSQDTNIPIYAQIFTD
2bjqA1          --------------------------------------------------------YRDPFPAARNPI--
1w93A3          --------IPWSGTGVDTVHVDEKTGLVSV-----DDDIYQKGCCTSPEDG-LQKAKRIGFPVMIKASEG
1e4eA1          QGLFELSGIPFVGCDIQSSAICM-----------------------------------------------
1l9aA           --------------WPSYIDKKKSRREGRKVPEELAIEKPSLKDI-------EKALKKLGLEPKIYRDKI
1g5qA           INIVENLVLPASANTINKIANGICDNLLTTVLTGYQKLFIFPNMNIRMLQKNIDLLKNNDVKVYSPDMNK
1ou0A           -------SVIVIGNAPTALLEAXRXIEENGWYDIPIVGIPVG--FINASKAK-EGLVSSHIEYSVEGHRG


                         +         .         .         .         .         *         .:210
query           GSSVATTLVESKEAVKDAVLEALKYDTEVMIEEYIKGDEITCPIIDGKMLPVLAIKPKGKFFDIASKYGD
1e4eA2          GSSFGVKKVNSADELDYAIESARQYDSKILIEQAVSGCEVGCAVLGNSAALVVGIRLQYGIFRIHQEVEP
1iovA2          GSSVGMSKVVAENALQDALRLAFQHDEEVLIEKWLSGPEFTVAILGEEILPSIRIQPSGTFYDYEAKYLS
1ehiA2          GSSVGISRVTNAEEYTEALSDSFQYDYKVLIEEAVNGAELEVGVIGNDQPLVSEIGAHTGWYDYNNKFVD
1vkzA3          ARGKGVLILDSKEETIEKGSKLIIVKGPVVIDEFLAGNELSAXAVVNGRVILPFVRDYKRLXDGDRGPNT
1ehiA1          ----------------------------------------------------------------------
1gsoA3          IVAMTLEEAEAAVHDMLAGNAFGDAGHRIVIEEFLDGEEASFIVMGEHVLPMATSQDHKRVGDKDTGPNT
1cqiB2          KEDIRAFAENWLGKRLVTYQTNGQPVNQILVEAATDIAELYLGAVSRRVVFMASTEGGVEIEKVAEETPH
1eyzA3          SSGKGQTFIRSAEQLAQAWKYAQGRAGRVIVEGVVKFDEITLLTVSAVDGVHFC------APVGHRQEDG
1bncA3          V-------VRGDAELAQSISMTRAEAKMVYMEKYLENPRHVEIQVLADGQGNAIYLA-ERDCSMQRRHQK
2pbzA2          KPDELYFVRIEGSELEERLSPYRIPGVYLYVHFFYSPILERLELLGVDERVLIAD----GNARWPVKPLP
1b6rA3          QWRLRANETEQLPAECY--------GECIVEQGINFSGEVSLVGARGFDGSTVFY-----PLTHNLHQDG
1a9xA5          MGGSGGGIAYNREEFEEICARGLDLTKELLIDESLIGKEYEMEVVRDKNDNCIIVCSIENFDAMGIHTGD
3eeqA1          INNCLTPPSKTKGVAEISALIAGGRNSKLILRKIAISRNSTIAVATY-----------------------
1a9xA6          I-------------VYDEADLRRYFQTAVLLDHFLDDAVEVDVDAICDGEMVLIGGIMEHIEQAGVHSGD
1iovA1          ----------------------------------------------------------------------
1glvA2          SIFRVKEGDPNLGVIAETL--TEHGTRYCMAQNYLPAIKDGD----------KRVLVVDGEPVPYCLARG
1pszA           SIAEQGKEGDSYYSMMKYNLDKIA----------------------------------------------
2bjqA1          -AAGGRKVKSDDGTEMFQYVALWEHGQPVFGRAYPDSADKTLANFWGGQENAGAVVPDPDILGFEYKW--
1w93A3          GGGKGIRQVEREEDFIALYHQAANEGSPIFIMKLARARHLEVQLLDQYGTNISLF---GRDCSVQRRHQK
1e4eA1          ----------------------------------------------------------------------
1l9aA           AGRVEVDYKGNKLCLLKEIAKIIKGK--------------------------------------------
1g5qA           SFEISSGRYKNNITMPNIENVL------------------------------------------------
1ou0A           GSPIAASIVNGFG---------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           GGADEFIVELNEDLHKEVEKMALETYKLLKCDVYARVDMLVKDNIPYVLEVNTLPGMTKNSLFPKSAAGI
1e4eA2          EKGSENAVDLSAEERGRIQETVKKIYKTLGCRGLARVDMFLDNGRIVLNEVNTLPGFTSYSRYPRMMAAA
1iovA2          DETQYFCAGLEASQEANLQALVLKAWTTLGCKGWGRIDVMLSDGQFYLLEANTSPGMTSHSLVPMAARQA
1ehiA2          NSAVHFQIQLSPEVTKEVKQMALDAYKVLNLRGEARMDLLDENNVPYLGEPNTLPGFTNMSLFKRLWDYS
1vkzA3          GGXGSWGVEIPSDTIKKIEELFDKTLWGVEKEGYAYRGFLLHDGDPYILEYNVRLGDPETEVIVT-LNPE
1ehiA1          ----------------------------------------------------------------------
1gsoA3          GGAPVVTDDVHQRTMERIIWPTVKGMAAEGNTFLYAGLMIDKQGNPKVIEFNCRFGDLETQPIMLRM---
1cqiB2          LIHKVALGPMPYQGRELAFKLGLEGKLVQQFTKIFMGLATILERDLALIEINPLVITKQGDLICKLGADG
1eyzA3          DYRESWQPQMSPLALERAQEIARKVVLALGGYGLFGVELFVCGDEVIFSEVSPRPHDT----GMVTLISQ
1bncA3          VVEEAPAPGITPELRRYIGERCAKACVDIGYRGAGTFEFLFENGEFYFIEMNTRIQVEHPVTEM--ITGV
2pbzA2          YTIVGNRIALRESLLPQLYDYGLAFVEPPGVIGPFALHFAYDGS-FKAIGIASRIDGGSNADHWELYWGE
1b6rA3          ILRTSVAPQANAQQQARAEEMLSAIMQELGYVGVMAMECFVTPQGLLINELAPRVHNS--GHWTQNGASI
1a9xA5          SITVAPAQTLTDKEYQIMRNASMAVLREIGVETGSNVQFAVKNGRLIVIEMNPRVSRS------------
3eeqA1          ----------------------------------------------------------------------
1a9xA6          SACSLPAYTLSQEIQDVMRQQVQKLAFELQVRGLMNVQFAVKNNEVYLIEVNPRAART----VPFVSKAT
1iovA1          ----------------------------------------------------------------------
1glvA2          GG------GEPRPLTESDWKIARQIGPTLKEKGLIFVGLDIIG--DRLTEINVTSPTC----IREIEAEF
1pszA           ----------------------------------------------------------------------
2bjqA1          ----------------------------------------------------------------------
1w93A3          IIEEAPVTIAKAETFHEMEKAAVRLGKLVGYVSAGTVEYLYDDGKFYFLELNP-----------------
1e4eA1          ----------------------------------------------------------------------
1l9aA           ----------------------------------------------------------------------
1g5qA           ----------------------------------------------------------------------
1ou0A           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           NMSFEELLDTIIEKSLKVNRE
1e4eA2          GISLPELIDRLIVLALK----
1iovA2          GMSFSQLVVRILE--------
1ehiA2          DINNAKLVDMLIDYGF-----
1vkzA3          GF-VNAVLEGY----------
1ehiA1          ---------------------
1gsoA3          KSDLVELCLAACESKL-----
1cqiB2          N--ALFRQPDLRE--------
1eyzA3          DLSEFALHVRAFL--------
1bncA3          DL-IKEQLRIAAGQPLSIKQE
2pbzA2          RLS------------------
1b6rA3          SQ-FELHLRAITDLPL-----
1a9xA5          ---------------------
3eeqA1          ---------------------
1a9xA6          GVPLAKVAARVMA--------
1iovA1          ---------------------
1glvA2          PVSITGMLMDAIEARLQ----
1pszA           ---------------------
2bjqA1          ---------------------
1w93A3          ---------------------
1e4eA1          ---------------------
1l9aA           ---------------------
1g5qA           ---------------------
1ou0A           ---------------------