[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for cper0:BAB81104.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1a69A.bssp"
#ERROR : Can't open dsspfile "1nw4A.bssp"
#ERROR : Can't open dsspfile "1k3fA.bssp"
#ERROR : Can't open dsspfile "1jysA.bssp"
#ERROR : Can't open dsspfile "1a9oA.bssp"
#ERROR : Can't open dsspfile "1ybfA.bssp"
#ERROR : Can't open dsspfile "1cb0A.bssp"
#ERROR : Can't open dsspfile "1t8rA.bssp"
#ERROR : Can't open dsspfile "1ys3A1.bssp"

## Summary of PDB Search
:235
    6e-90  52%  1a69A  [c.56.2.1] PURINE NUCLEOSIDE PHOSPHORYLASE
    1e-68  24%  1nw4A  [c.56.2.1] URIDINE PHOSPHORYLASE, PUTATIVE
    2e-45  29%  1k3fA  [c.56.2.1] URIDINE PHOSPHORYLASE
    1e-40  21%  1jysA  [c.56.2.1] MTA/SAH NUCLEOSIDASE
    4e-33  19%  1a9oA  [c.56.2.1] PURINE NUCLEOSIDE PHOSPHORYLASE
    6e-33  20%  1ybfA  [c.56.2.1] AMP NUCLEOSIDASE
    2e-30  16%  1cb0A  [c.56.2.1] PROTEIN (5'-DEOXY-5'-METHYLTHIOADENOSINE
    3e-21  15%  1t8rA  [c.56.2.1] AMP NUCLEOSIDASE
    6e-04  21%  1ys3A1 [d.122.1.3] SENSOR-TYPE HISTIDINE KINASE PRRB A:299 -- 446
:235

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MSIHIGAKEGQIAETILLPGDPLRAKFIAETFLENPVCYNEVRGMLGYTGTYKGKRISVQGTGMGVPSIS
1a69A           ---HINAEMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCS
1nw4A           LLRHLKISKEQITPVVLVVGDPGRVDKIK-VVCDSYVDLAYNREYKSVECHYKGQKFLCVSHGVGSAGCA
1k3fA           ---HLGLTKNDLATLAIVPGDPDRVEKIAA-LMDKPVKLASHREFTTWRAELDGKPVIVCSTGIGGPSTS
1jysA           ----------------IIGAMEEEVTLLRDKIENRQT--ISLGGCEIYTGQLNGTEVALLKSGIGKVAAA
1a9oA           ----------------------------------FPESTVPGHAGRLVFGILNGRACVMMYEGYPFWKVT
1ybfA           -----------------------------HVFAEHYG--VPIVGEHTSXPNASAEGVTLINFGXGSANAA
1cb0A           -----------------------------------------------ILGKIKNVDCVLHGRQHTIMPSK
1t8rA           GCSQILDPDSPYIALSCAGGNWITAETEAPEEAISDLAWKKHQXPAWHLITADGQGITLVNIGVGPSNAK
1ys3A1          ----------VPSPTCIIVGLPAGLRLAVDNAIANAVKHGGATLVLSAVSSRAGVEIAIDDNGSGVP---


                         .         .         *         .         .         .         .:140
query           IYVNELIRDYGVKNLIRVGTAGGMQEDIKVRDLVLAMSSHTDSAINKVRFNGLDFAPTASFKLLKAAYDT
1a69A           IYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRNAVDA
1nw4A           VCFEELCQ-NGAKVIIRAGSCGSLQPDIKRGDICICNAAVREDRVSHLLIHG-DFPAVGDFDVYDTLNKC
1k3fA           IAVEELAQ-LGIRTFLRIGTTGAIQPHINVGDVLVTTASVRLDGASL-HFAPLEFPAVADFECTTALVEA
1jysA           LGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVSDEDVTAFGYEYGQLPGCPAGFKADDKLIAAAEAC
1a9oA           FPVR-VFRLLGVETLVVTNAAGGLNPNFEVGDIMLI-----RDHINLPGFSGEAMSDAYDRDMRQKAHST
1ybfA           TIXDLLWA-IHPKAVIFLGKCGGLKLENALGDYLLPIAAIRGEGTSN-DYLPEEVPSLPSFSVLRAISSA
1cb0A           VNYQANIWEEGCTHVIVTTACGSLREEIQPGDIVII-----DQFIDRTTMRPQPMAEPFCPKTREVLIET
1t8rA           TICDHLA-VLRPDVWLXIGHCGGLRESQAIGDYVLAHAYLRDDHVLDAVLPPDIPIPALYDATKLVSGRP
1ys3A1          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           AVEKGYSPKVGSVFTADSFYNDNPEAWKQWAKFGTLAVEMETAALYTLAAKYGVNALTILTISDHLITAE
1a69A           AKALGIDARVGNLFSADLFYSPDGEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHE
1nw4A           AQELNVPVFNGISVSSDMYYPNKPSRLEDYSKANAAVVEMELATLMVIGTLRKVKTGGILIVDGCPFKWD
1k3fA           AKSIGATTHVGVTASSDTFYPGFKGSMEEWQAMGVMNYEMESATLLTMCASQGLRAGMVAGVIVNRTQQE
1jysA           IAELNLNAVRGLIVSGDAFINGSVGLAKIRHNFQAIAVEMEATAIAHVCHNFNVPFVVVRAISDV---AD
1a9oA           WKQMGEQRELGTYVMLGGPNFETVAECRLLRNLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDT
1ybfA           IQNKGKDYWTGTVYTTNRRVWEYDEKFKDLRSTHASGVDXETATLXTVGFANKIPXGALLLISDR-----
1cb0A           AKKLGLRCHSKGTMVTIEGPRSSRAESFMFRTWGADVINMTTVPEVVLAKEAGICYASIAMATDY--DCW
1t8rA           GEEVKQRLRTGTVVTTDDRNWELRYSALRFNLSRAVAIDXESATIAAQGYRFRVPYGTLLCVSDKPLHGE
1ys3A1          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           ETTSEERQTTFTKMMEVALDAAITL
1a69A           QTTAAERQTTFNDMIKIALESVL--
1nw4A           EGDFDNNLVQLENMIKIALGACAKL
1k3fA           IPNAETMKQTESHAVKIVVEAARRL
1jysA           QSFDEFLAVAAKQSSLMVESLVQKL
1a9oA           E---SQGKANHEEVLEAGKQAAQKL
1ybfA           -------------------------
1cb0A           AVSVDRVLKTLKENANKAKSLLLTT
1t8rA           IKLPGQANRFYEGAISEHLQIGIRA
1ys3A1          -------------------------