[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for cper0:BAB81143.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1gpjA3.bssp"
#ERROR : Can't open dsspfile "1omoA.bssp"
#ERROR : Can't open dsspfile "1npdA1.bssp"
#ERROR : Can't open dsspfile "1nvtA1.bssp"
#ERROR : Can't open dsspfile "1e0dA1.bssp"
#ERROR : Can't open dsspfile "1xq6A.bssp"
#ERROR : Can't open dsspfile "1i36A2.bssp"
#ERROR : Can't open dsspfile "1gpjA2.bssp"
#ERROR : Can't open dsspfile "1u7hA.bssp"
#ERROR : Can't open dsspfile "1hkuA1.bssp"
#ERROR : Can't open dsspfile "2nacA1.bssp"

## Summary of PDB Search
:400
    7e-34  26%  1gpjA3 [d.58.39.1] GLUTAMYL-TRNA REDUCTASE A:1 -- 143
    1e-07  17%  1omoA  [c.2.1.13] ALANINE DEHYDROGENASE
    1e-06  17%  1npdA1 [c.2.1.7] HYPOTHETICAL SHIKIMATE 5-DEHYDROGENASE-LIKE A:107
    1e-05  19%  1nvtA1 [c.2.1.7] SHIKIMATE 5'-DEHYDROGENASE A:111 -- 287
    4e-05  18%  1e0dA1 [c.5.1.1] UDP-N-ACETYLMURAMOYLALANINE--D-GLUTAMATE LIGASE
    1e-04  24%  1xq6A  [c.2.1.2] UNKNOWN PROTEIN
    3e-04  18%  1i36A2 [c.2.1.6] CONSERVED HYPOTHETICAL PROTEIN MTH1747 A:1 -- 152
    5e-04  31%  1gpjA2 [c.2.1.7] GLUTAMYL-TRNA REDUCTASE A:144 -- 302
    5e-04  18%  1u7hA  [c.2.1.13] ORNITHINE CYCLODEAMINASE
    0.001  12%  1hkuA1 [c.2.1.4] C-TERMINAL BINDING PROTEIN 3 A:115 -- 307
    0.001  15%  2nacA1 [c.2.1.4] NAD-DEPENDENT FORMATE DEHYDROGENASE A:148 -- 335
:400

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xIGVIGVKRNVDIAIREKLALYPKKHKKYVGELLNSFKEVVILNTCNRTEIYFNCTEEISEDEIFDKIFN
1gpjA3          -LVSVGITKEAEVEELEKARFESDEAVRDIVES-FGLSGSVLLQTSNRVEVYASGARDRAEELG------
1omoA           ----------------------------------------------------------------------
1npdA1          ----------------------------------------------------------------------
1nvtA1          ----------------------------------------------------------------------
1e0dA1          ----------------------------------------------------------------------
1xq6A           ----------------------------------------------------------------------
1i36A2          ----------------------------------------------------------------------
1gpjA2          ----------------------------------------------------------------------
1u7hA           ----------------------------------------------------------------------
1hkuA1          ----------------------------------------------------------------------
2nacA1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           VFNWNDDLKKYMFLSKEKRAVTHLMEVICGFHSRILGEDQILGQIKDAYKTAISDNSISSELQKMFEIAI
1gpjA3          -----DLIHDDAWVKRGSEAVRHLFRVASGLESMMVGEQEILRQVKKAYDRAARLGTLDEALKIVFRRAI
1omoA           ----------------------------------------------------------------------
1npdA1          ----------------------------------------------------------------------
1nvtA1          ----------------------------------------------------------------------
1e0dA1          ----------------------------------------------------------------------
1xq6A           ----------------------------------------------------------------------
1i36A2          ----------------------------------------------------------------------
1gpjA2          ----------------------------------------------------------------------
1u7hA           ----------------------------------------------------------------------
1hkuA1          ----------------------------------------------------------------------
2nacA1          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           ACGKKFKTECKMxxxxxxxxxxxxxxxxLKGCRKFMVLGYGEIGKLAIKHLLSHKVECIYLIVRDKSKAS
1gpjA3          NLGKRAREETRI----------------------------------------------------------
1omoA           --------------------------------SVFGFIGCGTQAYFQLEALRRVFIGEVKAYDVREKAAK
1npdA1          ----------------------------IKG-KTXVLLGAGGASTAIGAQGAIEGLKEIKLFNRRDEFFD
1nvtA1          --------------------------------KNIVIYGAGGAARAVAFELAKDNNIIIANRTVEKAEAE
1e0dA1          --------------------------------KNVVIIGLGLTGLSCVDFFLARGVTPRVMDTRMTPPGL
1xq6A           ----------------------------------------GRTGQIVYKKLKGSDKFVAKGLVRSAQGKE
1i36A2          ---------------------------------RVGFIGFGEVAQTLASRLRSRGVEVVT-SLEGRSPST
1gpjA2          ----------------------------LHD-KTVLVVGAGEMGKTVAKSLVDRGVRAVLVANRTYRAVE
1u7hA           ------------------------------------LIGNGAQSELAFHKHLG--IEEIVAYDTDPLATA
1hkuA1          -------------------------------GETLGIIGLGRVGQAVALRAKAFGFNVLYDPYLSDGIER
2nacA1          --------------------------------MHVGTVAAGRIGLAVLRRLAPFDVHLHYTDRHRLPESV


                         .         .         .         +         .         .         .:280
query           DLEGEIVEVLDFNEKNQVINEVDCIVSCTAAPHTVVRNEDIKTEGDIIHIYDLAVPRDVDKELSEKERVx
1gpjA3          ----------------------------------------------------------------------
1omoA           KFYCEDRGISASVQPAEEASRCDVLVTTTPSRKPVVKAEWVEEGTHINAIADGPGKQELDVEILKKAKI-
1npdA1          KALAFAVTVTDLADQQAFLASADILTNGTKVGXKPLENESLVNDISLLHVTECVYNPHXTKLLQQ-----
1nvtA1          KLNKKFGEEVKFSGLDVDLDGVDIIINATPI---------------------------------------
1e0dA1          DKLPEAVERHTGSLNDEWLMAADLIVASPGIAL-------------------------------------
1xq6A           KIGGEAVFIGDITDANPAFQGIDALVILTSAVPKMKPGFDPTKGGRPEFIFDGQYPEQVDWI--------
1i36A2          IERARTVGVTETSE--EDVYSCPVVISAVTP---------------------------------------
1gpjA2          LARDLGGEAVRFDELVDHLARSDVVVSATAAPHPVIHVDDVREARSPILIIDIANPRDVEEGVENIEDV-
1u7hA           KLIANLKEYSGLTIRAEAVKGVDIITTVTADKAYIITPDXLEPGXHLNAVGDCPGKTELHADVLRNARV-
1hkuA1          ALGLQRVSTLQ-----DLLFHSDCVTLHNEHNHHLINDFTVQMRQGAFLV--------------------
2nacA1          EKELNLTWHATREDMYPVCDVVTLNCPLHPETEHMINDETLKKRGAYIVNTKLCDRDAVARALESG----


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1gpjA3          ----------------------------------------------------------------------
1omoA           ----------------------------------------------------------------------
1npdA1          ----------------------------------------------------------------------
1nvtA1          ----------------------------------------------------------------------
1e0dA1          ----------------------------------------------------------------------
1xq6A           ----------------------------------------------------------------------
1i36A2          ----------------------------------------------------------------------
1gpjA2          ----------------------------------------------------------------------
1u7hA           ----------------------------------------------------------------------
1hkuA1          ----------------------------------------------------------------------
2nacA1          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1gpjA3          --------------------------------------------------
1omoA           --------------------------------------------------
1npdA1          --------------------------------------------------
1nvtA1          --------------------------------------------------
1e0dA1          --------------------------------------------------
1xq6A           --------------------------------------------------
1i36A2          --------------------------------------------------
1gpjA2          --------------------------------------------------
1u7hA           --------------------------------------------------
1hkuA1          --------------------------------------------------
2nacA1          --------------------------------------------------