[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for cper0:BAB81144.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1zj8A2.bssp"
#ERROR : Can't open dsspfile "2akjA4.bssp"
#ERROR : Can't open dsspfile "1aopA1.bssp"
#ERROR : Can't open dsspfile "1zj8A3.bssp"
#ERROR : Can't open dsspfile "2akjA1.bssp"
#ERROR : Can't open dsspfile "1aopA4.bssp"
#ERROR : Can't open dsspfile "1kqfB1.bssp"
#ERROR : Can't open dsspfile "2v4jA3.bssp"
#ERROR : Can't open dsspfile "1zj8A1.bssp"
#ERROR : Can't open dsspfile "2akjA2.bssp"
#ERROR : Can't open dsspfile "1durA.bssp"
#ERROR : Can't open dsspfile "2v4jB2.bssp"
#ERROR : Can't open dsspfile "2v4jA1.bssp"
#ERROR : Can't open dsspfile "2v4jB3.bssp"
#ERROR : Can't open dsspfile "1hfeL2.bssp"
#ERROR : Can't open dsspfile "1iqzA.bssp"
#ERROR : Can't open dsspfile "1gt8A1.bssp"
#ERROR : Can't open dsspfile "1jb0C.bssp"
#ERROR : Can't open dsspfile "1h98A.bssp"
#ERROR : Can't open dsspfile "2v4jB1.bssp"
#ERROR : Can't open dsspfile "1aopA2.bssp"
#ERROR : Can't open dsspfile "2fug91.bssp"
#ERROR : Can't open dsspfile "1jnrB.bssp"
#ERROR : Can't open dsspfile "2akjA3.bssp"
#ERROR : Can't open dsspfile "1a6lA.bssp"
#ERROR : Can't open dsspfile "1aopA3.bssp"
#ERROR : Can't open dsspfile "1bluA.bssp"
#ERROR : Can't open dsspfile "1kf6B1.bssp"
#ERROR : Can't open dsspfile "1c4aA3.bssp"
#ERROR : Can't open dsspfile "1gt8A5.bssp"
#ERROR : Can't open dsspfile "2gmhA3.bssp"
#ERROR : Can't open dsspfile "1fxdA.bssp"
#ERROR : Can't open dsspfile "1d0cA.bssp"
#ERROR : Can't open dsspfile "1b0pA5.bssp"
#ERROR : Can't open dsspfile "1xerA.bssp"
#ERROR : Can't open dsspfile "1h0hB.bssp"
#ERROR : Can't open dsspfile "1ti2B2.bssp"
#ERROR : Can't open dsspfile "1nekB1.bssp"
#ERROR : Can't open dsspfile "2fug34.bssp"
#ERROR : Can't open dsspfile "1g8jA2.bssp"

## Summary of PDB Search
:326
    1e-17  28%  1zj8A2 [d.58.36.1] PROBABLE FERREDOXIN-DEPENDENT NITRITE REDUCTASE
    7e-14  13%  2akjA4 [d.134.1.1] FERREDOXIN--NITRITE REDUCTASE, CHLOROPLAST A:175
    3e-13  34%  1aopA1 [d.58.36.1] SULFITE REDUCTASE HEMOPROTEIN A:81 -- 145
    4e-13  17%  1zj8A3 [d.134.1.1] PROBABLE FERREDOXIN-DEPENDENT NITRITE REDUCTASE
    4e-13  28%  2akjA1 [d.58.36.1] FERREDOXIN--NITRITE REDUCTASE, CHLOROPLAST
    3e-12  20%  1aopA4 [d.134.1.1] SULFITE REDUCTASE HEMOPROTEIN A:426 -- 570
    2e-11  25%  1kqfB1 [d.58.1.5] FORMATE DEHYDROGENASE, NITRATE-INDUCIBLE, IRON-
    4e-11  18%  2v4jA3 [d.134.1.1] SULFITE REDUCTASE, DISSIMILATORY-TYPE SUBUNIT
    5e-11  19%  1zj8A1 [d.58.36.1] PROBABLE FERREDOXIN-DEPENDENT NITRITE
    6e-11  28%  2akjA2 [d.58.36.1] FERREDOXIN--NITRITE REDUCTASE, CHLOROPLAST A:22
    3e-10  33%  1durA  [d.58.1.1] 2[4FE-4S] FERREDOXIN
    3e-10  25%  2v4jB2 [d.58.36.2] SULFITE REDUCTASE, DISSIMILATORY-TYPE SUBUNIT
    6e-10  15%  2v4jA1 [d.58.1.5] SULFITE REDUCTASE, DISSIMILATORY-TYPE SUBUNIT
    8e-10  22%  2v4jB3 [d.134.1.1] SULFITE REDUCTASE, DISSIMILATORY-TYPE SUBUNIT
    3e-09  20%  1hfeL2 [d.58.1.5] PROTEIN (FE-ONLY HYDROGENASE (E.C.1.18.99.1) L:2
    4e-09  22%  1iqzA  [d.58.1.4] FERREDOXIN
    4e-09  11%  1gt8A1 [a.1.2.2] DIHYDROPYRIMIDINE DEHYDROGENASE A:2 -- 183
    6e-09  25%  1jb0C  [d.58.1.2] PHOTOSYSTEM I IRON-SULFUR CENTER
    6e-09  26%  1h98A  [d.58.1.2] FERREDOXIN
    1e-08  14%  2v4jB1 [d.58.1.5] SULFITE REDUCTASE, DISSIMILATORY-TYPE SUBUNIT
    1e-08  21%  1aopA2 [d.58.36.1] SULFITE REDUCTASE HEMOPROTEIN A:346 -- 425
    2e-08  20%  2fug91 [d.58.1.5] NADH-QUINONE OXIDOREDUCTASE CHAIN 9 9:26 -- 179
    4e-08  21%  1jnrB  [d.58.1.5] ADENYLYLSULFATE REDUCTASE
    6e-08  18%  2akjA3 [d.134.1.1] FERREDOXIN--NITRITE REDUCTASE, CHLOROPLAST A:431
    1e-07  25%  1a6lA  [d.58.1.2] FERREDOXIN
    2e-07  25%  1aopA3 [d.134.1.1] SULFITE REDUCTASE HEMOPROTEIN A:149 -- 345
    2e-07  31%  1bluA  [d.58.1.1] FERREDOXIN
    2e-07   7%  1kf6B1 [a.1.2.1] FUMARATE REDUCTASE IRON-SULFUR PROTEIN B:106 --
    4e-07  30%  1c4aA3 [d.58.1.5] PROTEIN (FE-ONLY HYDROGENASE) A:127 -- 209
    4e-07  23%  1gt8A5 [d.58.1.5] DIHYDROPYRIMIDINE DEHYDROGENASE A:845 -- 1020
    4e-07  16%  2gmhA3 [d.58.1.6] ELECTRON TRANSFER FLAVOPROTEIN-UBIQUINONE A:483
    7e-07  30%  1fxdA  [d.58.1.4] FERREDOXIN II
    7e-07   8%  1d0cA  [d.174.1.1] BOVINE ENDOTHELIAL NITRIC OXIDE SYNTHASE HEME
    1e-06  16%  1b0pA5 [d.58.1.5] PROTEIN (PYRUVATE-FERREDOXIN OXIDOREDUCTASE)
    2e-06  24%  1xerA  [d.58.1.3] FERREDOXIN
    2e-06  13%  1h0hB  [d.58.1.5] FORMATE DEHYDROGENASE (SMALL SUBUNIT)
    2e-06  33%  1ti2B2 [d.58.1.5] PYROGALLOL HYDROXYTRANSFERASE SMALL SUBUNIT B:1
    4e-06  13%  1nekB1 [a.1.2.1] SUCCINATE DEHYDROGENASE IRON-SULFUR PROTEIN B:107
    1e-05  15%  2fug34 [d.58.1.5] NADH-QUINONE OXIDOREDUCTASE CHAIN 3 3:96 -- 246
    1e-04  16%  1g8jA2 [c.81.1.1] ARSENITE OXIDASE A:6 -- 682
:326

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxDINTKKLKKNAFRVTKRRGYTASRIRVPGGHLDAKLLLNIQEIADTYGDGTVHITTRQGFEIPGIDM
1zj8A2          ---------------------KYFMMRVRCDGGALSAAALRTLGQISTEFARDTADISDRQNVQYHWIEV
2akjA4          ----------------------------------------------------------------------
1aopA1          --------------------------RCRLPGGVITTKQWQAIDKFAGENIYGSIRLTNRQTFQFHG---
1zj8A3          ----------------------------------------------------------------------
2akjA1          --------------------------GLHIPVGRLQADEMEELARIADVYGSGELRLTVEQNIIIPNVEN
1aopA4          ----------------------------------------------------------------------
1kqfB1          ----------------------------------------------------------------------
2v4jA3          ----------------------------------------------------------------------
1zj8A1          -------------------KNGLNAVGVAPIAGRVSGTILTAVADLMARAGSDRIRFTPYQKLDIPDALL
2akjA2          ---DIDVRLKWLGLFHRRKHHYGRFMRLKLPNGVTTSEQTRYLASVIKKYGDGCADVTTRQNWQIRGVVL
1durA           ----------------------------------------------------------------------
2v4jB2          ---------------------------VRVGARLMSITHIREMCDIADKYCGGHLRFTTRNNVEFMVADE
2v4jA1          ----------------------------------------------------------------------
2v4jB3          ----------------------------------------------------------------------
1hfeL2          ----------------------------------------------------------------------
1iqzA           ----------------------------------------------------------------------
1gt8A1          ----------------------------------------------------------------------
1jb0C           ----------------------------------------------------------------------
1h98A           ----------------------------------------------------------------------
2v4jB1          ----------------------------------------------------------------------
1aopA2          ---------------------DNWHLTLFIENGRIARPLKTGLLEIAKIHK-GDFRITANQNLIIAGVPE
2fug91          ----------------------------------------------------------------------
1jnrB           ----------------------------------------------------------------------
2akjA3          ----------------------------------------------------------------------
1a6lA           ----------------------------------------------------------------------
1aopA3          ----------------------------------------------------------------------
1bluA           ----------------------------------------------------------------------
1kf6B1          ----------------------------------------------------------------------
1c4aA3          ----------------------------------------------------------------------
1gt8A5          ----------------------------------------------------------------------
2gmhA3          ----------------------------------------------------------------------
1fxdA           ----------------------------------------------------------------------
1d0cA           ----------------------------------------------------------------------
1b0pA5          ----------------------------------------------------------------------
1xerA           ----------------------------------------------------------------------
1h0hB           ----------------------------------------------------------------------
1ti2B2          ----------------------------------------------------------------------
1nekB1          ----------------------------------------------------------------------
2fug34          ----------------------------------------------------------------------
1g8jA2          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           KDIPEVNKKLQxxxxxxxINQENPGDGYNAAGTRNVSACIGNNVCPFANYNTTNFAKKIEKAIFPNDLHF
1zj8A2          ENVPEIWRRLD-----------------------------------------------------------
2akjA4          ---------------------------------RNPVGNPLAGIDPHEIVDTRPFTNLISQFVTANSRGW
1aopA1          --ILPVHQMLH-----------------------------------------------------------
1zj8A3          -----------------------------SHWRRNLMACSGIEFCKLSFAETRVRAQHLVPELSQLDVPI
2akjA1          SKIDSLLNEP------------------------------------------------------------
1aopA4          ---------------------------------ENSMACVSFPTCPLAMAEAERFLPSFIDNIDNLDEHI
1kqfB1          ----------------------------------DVSTCIGCKACQVACSEWNDIRDEVGHCVGVYDNPA
2v4jA3          ---------------------------------RTPESCLGKSRCEFACYDSQAACYELTMEYQDEPYKF
1zj8A1          DDL-------------------------------------------------------------------
2akjA2          PDVPEIIKGLE-----------------------------------------------------------
1durA           ----------------------------------------------------------------------
2v4jB2          ASLKALKEDL------------------------------------------------------------
2v4jA1          ----------------------------------------------------------------------
2v4jB3          -----------------------------GAGVSNIVHTQGWVHCHTPATDASGPVKAIMDEVFELPAPV
1hfeL2          ----------------------------------------------------------------------
1iqzA           ----------------------------------------------------------------------
1gt8A1          ----------------------------------------------------------------------
1jb0C           ----------------------------------------------------------------------
1h98A           ----------------------------------------------------------------------
2v4jB1          ----------------------------------------------------------------------
1aopA2          SEKAKIEK--------------------------------------------------------------
2fug91          ----------------------------------------------------------------------
1jnrB           ----------------------------------------------------------------------
2akjA3          ------------------------------ILMKGLVACTGSQFCGQAIIETALKVTEEVQRLVSVTRPV
1a6lA           ----------------------------------------------------------------------
1aopA3          ---------------------------------RNVLCT-SNPYESQLHAEAYEWAKKISEHLLPTYLKF
1bluA           ----------------------------------------------------------------------
1kf6B1          -----------------------------------------------------TNIQTPAQMAKYHQFSG
1c4aA3          ----------------------------------------------------------------------
1gt8A5          ----------------------------------------------------------------------
2gmhA3          ----------------------------------------------------------------------
1fxdA           ----------------------------------------------------------------------
1d0cA           ------------------PRVKNWELGYDTLCAQSQQDGPCTPRRCLGSLVLPRKGPPPAEQLLSQARDF
1b0pA5          ------------------------------------ENCIQCNQC---------AFVCPHSAILPVLAKE
1xerA           ----------------------------------------------------------------------
1h0hB           ----------------------------------DTTRCTACRGCQVA----CKQWHGNPATPTENTGFH
1ti2B2          ----------------------------------------------------------------------
1nekB1          -----------------------------------------------------EHLQMPEQREKLDGLYE
2fug34          --------------------------------------PLDCPTCDKGG--------ACELQDRTVEYGL
1g8jA2          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           KIALTGCPNDCIKARMHDFGIIGMTEPQYERNRCVSCGACVRACKKKATGALSFENFKVVRDGSKCIGCG
1zj8A2          ----------------------------------------------------------------------
2akjA4          NPCVIGSHDLYEHPHINDLAYMPATKNGKFGFNLLVGGFFSIKRCEEAIAMLEAFRDLGFRGNRQKCRMM
1aopA1          ----------------------------------------------------------------------
1zj8A3          TVNINGCPNSCARIQIADIGFKG-------QMIDDGHGGSVEGF--------------------------
2akjA1          ----------------------------------------------------------------------
1aopA4          VMRVTGCPNGCGRAMLAEVGLVGKAPGRYNLHLGGNRIGTTEPEILASLDELIGRWAKEREAGEGFGDFT
1kqfB1          DLS----AKSWTVMRFSETEQNGKLEWLIRKDGCMHCEGCLKACPSAGA-IIQYANGIVDFQSENCIGCG
2v4jA3          KFKFDACPNGCVASIRSDFSVIGT-WKRGASILCGAKAPILDGAQMGSLLV------PFVAAEEPFDEIK
1zj8A1          ----------------------------------------------------------------------
2akjA2          ----------------------------------------------------------------------
1durA           -------------------------------DSCIACGACKPECP---VNCIQEGSIYAI-DADSCIDCG
2v4jB2          ----------------------------------------------------------------------
2v4jA1          -----------------EFKPNAGAHSGRDWGKFDIEAEVVNRCP---SKCMKWDGSKLSIDNKECVRCM
2v4jB3          RISLACCINMCGAVHCSDIGVVGI---------------------HRGDGVVIMVGGKVSNRISMPKFSK
1hfeL2          -MERIEYEMHTPDPKADP---DKLHFVQIDEAKCIGCDTCSQYCPTAA-IFGEMGEPHSIPHIEACINCG
1iqzA           --------------------------TIVDKETCIACGACGAAEDGIAYVTLDDNQGIVEVPDILIDDMM
1gt8A1          -----TSISNKNYYGAAKMIFSDNPLGLTCGMVCPTSDLCVGGCNLYATEEGSILQQFASEVFKAMNIPQ
1jb0C           -------------------------HTVKIYDTCIGCTQCVRACPTDVLEMVPWDGIASSPRTEDCVGCK
1h98A           --------------------------PHVICEPCIGVKSCVEVCP---VECIYDGGDQFYIHPEECIDCG
2v4jB1          --------------------------DHEWTDQLCEIPLAVASCRPTKLEIGDKKVNTIAIKNERCMYCG
1aopA2          ----------------------------------------------------------------------
2fug91          -------------------GRHVLTRHPNGLEKCIGCSLCAAACPENPVSAGERYAKVYEINMLRCIFCG
1jnrB           -------------------------------EKCDGCKALERTACEYINDLMTLDKEKYNREPDMCWECY
2akjA3          RMHWTGCPNSCGQVQVADIGFMGCMTRCEGADVFVGGRIGSDSHLGDIYK-------KAVPCKDLVPVVA
1a6lA           ----------------------------VVTDNCIKCKDCVEVCP---VDCFYEGPNFLVIHPDECIDCA
1aopA3          KTTVVIPPQNDIDLHANDMNFVAI----------------------------------------------
1bluA           -------------------------------DECINCDVCEPECP---NGAISQGDETYVIEPSLCTECS
1kf6B1          CIN-------CGLCYAACPQFGLNPEFIGPAAITLAHRYNEDSRDHGKKER--MAQLNSQNGVWSCTFVG
1c4aA3          --------------------------LTVDRTKCLLCGRCVNACLNKNGKTIIGAEDEKCFDDTNCLLCG
1gt8A5          ----------------------------------VIGKALQYLGTFGEL--SNIEQVVAVIDEEMCINCG
2gmhA3          --------------------------VPVNRNLSIYDGPEQRFCPAGVVPLEQGDGFRLQINAQNCVHCK
1fxdA           --------------------------PIEVNDDCMAXEACVEICPD--VFEMNEEGDKVVINPDSDLDCV
1d0cA           INQYYSSKRSGSQAHEERLQEVEAEVASTGTYHLRESELVFGAKQAWRNAPRCVGRIQWGKLQYICNHIK
1b0pA5          EELVGAPANFTALEAKGKELKGYKFRIQINTLDCMGCGNCADICP---PKEKALVMQPLDTQRDAQVPNL
1xerA           ----------YGPVEPPXVLGIHGTIVGVDFDLCIADGSCINACPVNVPGHPASEKKADPVNEQACIFCM
1h0hB           QNPPDFNFHTYKLVRMHEQEIDGRIDWLFFPDQCRHCIPCKATADMEDESAIIHDDVLFTPKTKDLEDYE
1ti2B2          --------------------------------RPTPCMHCENACVAKGNGAVYQEDGIVLIDPEKAKGKK
1nekB1          CILCACCSTSCPSFWWNPDKFIG------PAGLLAAYRFLIDSRDTETDSRL--DGLSDAFSVFRCHSIM
2fug34          YEKLPVYTRFEFTRRHVDKHHPLSPFVILDRERCIHCKRCVRYFEEVPGDEVLHTFIGTMDFGLPSGFSG
1g8jA2          -----------------------RTNMTCHFC-IVGCGYHVYKWPELEEGGRAPEQNALGLDFRKQLPPL


                         .         .         .         +         .         .         .:280
query           ECVMNCPTNAWTRSKEKYYRLAIMGRTGKKNPRLAEDFILWVDEDSIIKIILNTYKYVTEYIAKDAPGGK
1zj8A2          ----------------------------------------------------------------------
2akjA4          WLI-------------------------------------------------------------------
1aopA1          ----------------------------------------------------------------------
1zj8A3          ----------------QVHLGGHLGLDAGFGRKLRQHKVTSDELGDYIDRVVRNFVKHRSE--------G
2akjA1          ----------------------------------------------------------------------
1aopA4          VRAGIIR---------------------------------------------------------------
1kqfB1          YCIAGCPFNIPRLNKED-----------------------------------------------------
2v4jA3          EVVEKIWD-WWMEEGKNR------ERLGETMKRLSQKLLEVTEIAPVPQHVKE-----------------
1zj8A1          ----------------------------------------------------------------------
2akjA2          ----------------------------------------------------------------------
1durA           SCASVCPVGA------------------------------------------------------------
2v4jB2          ----------------------------------------------------------------------
2v4jA1          HCINTMPRALHI----------------------------------------------------------
2v4jB3          VVVAYIPNE-------------------------------PPRWPSLTKTIKHIIEVYSANAYK-----Y
1hfeL2          QCLTHCPENA------------------------------------------------------------
1iqzA           DAFEGCPTDS------------------------------------------------------------
1gt8A1          IRNPCLPSQE------------------------------------------------------------
1jb0C           RCETACPTDF------------------------------------------------------------
1h98A           ACVPACPVNAIYPEEDV-----------------------------------------------------
2v4jB1          NCYTMCPALPIS----------------------------------------------------------
1aopA2          ----------------------------------------------------------------------
2fug91          LCEEACPTGAIVLGYDFEMADYEYSDLVYGKEDMLVD---------------------------------
1jnrB           SCVKMCPQGAIDVRGYVDYSPDIMWTVKYRNGKVLRFKFAI-----------------------------
2akjA3          EILINQ----------------------------------------------------------------
1a6lA           LCEPECPAQAIF----------------------------------------------------------
1aopA3          ----------------------------------------------------------------------
1bluA           QCVEVCPVDCIIELRAKYERIT------------------------------------------------
1kf6B1          YCSEVCPKHVDPAAAIQQGKVESSKDFLI-----------------------------------------
1c4aA3          QCIIACPVAALS----------------------------------------------------------
1gt8A5          KCYMTCNDSGYQAIQFDP----------------------------------------------------
2gmhA3          TCDIKDPSQNINWVVPEGGG--------------------------------------------------
1fxdA           EAIDSCPAEAIVRS--------------------------------------------------------
1d0cA           YAT--NRGNLRSAITVFPQRAPGRGDFRIWNSQLVRYAGYRQQDGSVR----------------------
1b0pA5          EYAARIP---------------------------------------------------------------
1xerA           ACVNVCPVAAID----------------------------------------------------------
1h0hB           SVISACPYDVPRKVAES-----------------------------------------------------
1ti2B2          ELLDTCPYGV------------------------------------------------------------
1nekB1          NCVSVCPKGLNPTRAIGHIKSMLLQRNA------------------------------------------
2fug34          NITDICPVGALLDLTARF----------------------------------------------------
1g8jA2          ASTLTPAMTNV-----------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           EHIGYIIDRTGFMEFKKxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1zj8A2          ----------------------------------------------
2akjA4          ----------------------------------------------
1aopA1          ----------------------------------------------
1zj8A3          ERFAQWVIRAEEDDLR------------------------------
2akjA1          ----------------------------------------------
1aopA4          ----------------------------------------------
1kqfB1          ----------------------------------------------
2v4jA3          ----------------------------------------------
1zj8A1          ----------------------------------------------
2akjA2          ----------------------------------------------
1durA           ----------------------------------------------
2v4jB2          ----------------------------------------------
2v4jA1          ----------------------------------------------
2v4jB3          ERLGEWAERIGWERFFS-----------------------------
1hfeL2          ----------------------------------------------
1iqzA           ----------------------------------------------
1gt8A1          ----------------------------------------------
1jb0C           ----------------------------------------------
1h98A           ----------------------------------------------
2v4jB1          ----------------------------------------------
1aopA2          ----------------------------------------------
2fug91          ----------------------------------------------
1jnrB           ----------------------------------------------
2akjA3          ----------------------------------------------
1a6lA           ----------------------------------------------
1aopA3          ----------------------------------------------
1bluA           ----------------------------------------------
1kf6B1          ----------------------------------------------
1c4aA3          ----------------------------------------------
1gt8A5          ----------------------------------------------
2gmhA3          ----------------------------------------------
1fxdA           ----------------------------------------------
1d0cA           ----------------------------------------------
1b0pA5          ----------------------------------------------
1xerA           ----------------------------------------------
1h0hB           ----------------------------------------------
1ti2B2          ----------------------------------------------
1nekB1          ----------------------------------------------
2fug34          ----------------------------------------------
1g8jA2          ----------------------------------------------