[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for cper0:BAB81145.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1ep1B2.bssp"
#ERROR : Can't open dsspfile "1tvcA2.bssp"
#ERROR : Can't open dsspfile "1cneA2.bssp"
#ERROR : Can't open dsspfile "1t6lA2.bssp"
#ERROR : Can't open dsspfile "1amoA3.bssp"
#ERROR : Can't open dsspfile "1cqxA3.bssp"
#ERROR : Can't open dsspfile "1fdrA2.bssp"
#ERROR : Can't open dsspfile "1gvhA3.bssp"
#ERROR : Can't open dsspfile "1qfjA1.bssp"
#ERROR : Can't open dsspfile "2piaA2.bssp"
#ERROR : Can't open dsspfile "1krhA2.bssp"
#ERROR : Can't open dsspfile "1a8pA2.bssp"
#ERROR : Can't open dsspfile "1qfjA2.bssp"
#ERROR : Can't open dsspfile "1krhA1.bssp"
#ERROR : Can't open dsspfile "1pvwA.bssp"
#ERROR : Can't open dsspfile "1a8pA1.bssp"
#ERROR : Can't open dsspfile "1ep1B1.bssp"
#ERROR : Can't open dsspfile "1b2rA2.bssp"
#ERROR : Can't open dsspfile "1cqxA2.bssp"
#ERROR : Can't open dsspfile "1cneA1.bssp"
#ERROR : Can't open dsspfile "1tvcA1.bssp"
#ERROR : Can't open dsspfile "1hhsA.bssp"
#ERROR : Can't open dsspfile "2piaA1.bssp"
#ERROR : Can't open dsspfile "1b2rA1.bssp"

## Summary of PDB Search
:263
    2e-21  21%  1ep1B2 [c.25.1.3] DIHYDROOROTATE DEHYDROGENASE B (PYRK SUBUNIT)
    1e-15  24%  1tvcA2 [c.25.1.2] METHANE MONOOXYGENASE COMPONENT C A:111 -- 251
    2e-15  21%  1cneA2 [c.25.1.1] NITRATE REDUCTASE A:125 -- 270
    1e-14  13%  1t6lA2 [d.131.1.2] DNA POLYMERASE PROCESSIVITY FACTOR A:136 -- 270
    2e-14  17%  1amoA3 [c.25.1.4] NADPH-CYTOCHROME P450 REDUCTASE A:519 -- 678
    5e-13  15%  1cqxA3 [c.25.1.5] FLAVOHEMOPROTEIN A:262 -- 403
    7e-13  21%  1fdrA2 [c.25.1.1] FLAVODOXIN REDUCTASE A:101 -- 248
    1e-12  21%  1gvhA3 [c.25.1.5] FLAVOHEMOPROTEIN A:254 -- 396
    2e-12  22%  1qfjA1 [b.43.4.2] PROTEIN (FLAVIN REDUCTASE) A:1 -- 97
    5e-12  21%  2piaA2 [c.25.1.2] PHTHALATE DIOXYGENASE REDUCTASE A:104 -- 223
    6e-12  21%  1krhA2 [c.25.1.2] BENZOATE 1,2-DIOXYGENASE REDUCTASE A:206 -- 338
    1e-11  17%  1a8pA2 [c.25.1.1] NADPH\:FERREDOXIN OXIDOREDUCTASE A:101 -- 258
    5e-11  19%  1qfjA2 [c.25.1.1] PROTEIN (FLAVIN REDUCTASE) A:98 -- 232
    2e-10  25%  1krhA1 [b.43.4.2] BENZOATE 1,2-DIOXYGENASE REDUCTASE A:106 -- 205
    1e-09  13%  1pvwA  [d.115.1.2] 3,4-DIHYDROXY-2-BUTANONE 4-PHOSPHATE SYNTHASE
    4e-09  27%  1a8pA1 [b.43.4.2] NADPH\:FERREDOXIN OXIDOREDUCTASE A:2 -- 100
    5e-09  23%  1ep1B1 [b.43.4.2] DIHYDROOROTATE DEHYDROGENASE B (PYRK SUBUNIT) B:2
    6e-09  18%  1b2rA2 [c.25.1.1] PROTEIN (FERREDOXIN-NADP+ REDUCTASE) A:142 -- 303
    1e-08  22%  1cqxA2 [b.43.4.2] FLAVOHEMOPROTEIN A:151 -- 261
    1e-08  15%  1cneA1 [b.43.4.2] NITRATE REDUCTASE A:11 -- 124
    1e-08  21%  1tvcA1 [b.43.4.2] METHANE MONOOXYGENASE COMPONENT C A:2 -- 110
    4e-07  11%  1hhsA  [e.8.1.6] RNA-DIRECTED RNA POLYMERASE
    8e-07  19%  2piaA1 [b.43.4.2] PHTHALATE DIOXYGENASE REDUCTASE A:1 -- 103
    5e-05  17%  1b2rA1 [b.43.4.2] PROTEIN (FERREDOXIN-NADP+ REDUCTASE) A:9 -- 141
:263

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xHNEYTPFISKILNVKKHTDIEYTFRMEFKGDVKPGQFFEVSLPKFGEAPISVSGIGEDYVELTIRRVGV
1ep1B2          ----------------------------------------------------------------------
1tvcA2          ----------------------------------------------------------------------
1cneA2          ----------------------------------------------------------------------
1t6lA2          ----------------------------------------------------------------------
1amoA3          ----------------------------------------------------------------------
1cqxA3          ----------------------------------------------------------------------
1fdrA2          ----------------------------------------------------------------------
1gvhA3          ----------------------------------------------------------------------
1qfjA1          -----TTLSCKVTSVEAITDTVYRVRIVPDASFRAGQYLMVVMDERDKRPFSMASTEKGFIELHIGYAKA
2piaA2          ----------------------------------------------------------------------
1krhA2          ----------------------------------------------------------------------
1a8pA2          ----------------------------------------------------------------------
1qfjA2          ----------------------------------------------------------------------
1krhA1          ----------TLARVENLSDSTITFDIQLDDHFLAGQYVNVTLPGTTETRSYSSQPGNRLTGFVVRNVGK
1pvwA           ---------GGLICTALHPDICNKLGIPFMVDIASQKFKVLRELYPNDSFSITINHRKTFTGITDNDRAF
1a8pA1          ----------RVLSVHHWNDTLFSFKTTRNPRFENGQFVMIGLEVDGRPLMRASPNYEEHLEFFSIKVGP
1ep1B1          ----------TVVSQREVAYNIFEMVLKGTLMDLPGQFLHLAVPNGAMLPISISSWDKRTCTILYRIGTT
1b2rA2          ----------------------------------------------------------------------
1cqxA2          ----------VIREKRPESDTSFILEPADGGPVEPGQYTSVAIDVPALGLQQSDMPNGRTYRISVKREGY
1cneA1          ----------RLVAKKELSRDVRLFRFSLPSGLPIGKHIFVCATIEGKLCPTSMVDEIGHFDLLVKVYFK
1tvcA1          --GEVGSFEAEVVGLNWVSSNTVQFLLQKRPDFEPGQFMDLTIPGTDVSSPANLPNPEGRLEFLIRVLGR
1hhsA           ----------------------------------------------------------KVNPSPYMKIGD
2piaA1          ----------KIASKEKIARDIWSFELTDPQGFEAGANLTVAVPNGSRRTYSLCNDSQERYVIAVKRDGG
1b2rA1          -YRPNAPFIGKVISNEPLVKEGGVQHIKFDLTYIEGQSIGIIPPGVDKNTRHGDDVDDKTISLCVRQLGV


                         .         .         *         .         .         .         .:140
query           VTNEIFEKYEGDKLFLRGPYGNGFDVNNYKGKEVIVVAGGTGLSPVKGIVDYFSQNPKDAESFTLISGFK
1ep1B2          ------------------PVAEVTS-----TDKILIIGGGIGVPPLYELAKQLEKTGCQ---MTILLGFA
1tvcA2          -----------------------FGLKERGMAPRYFVAGGTGLAPVVSMVRQMQEWTAPNE-TRIYFGVN
1cneA2          -----------------GSFVINGKQRNAR--RLAMICGGSGITPMYQIQAVLRDQPEDHTEMHLVYANR
1t6lA2          ----------------------------------------------------------------------
1amoA3          ------------------------------TTPVIMVGPGTGIAPFMGFIQERAWLREQGETLLYYGCRR
1cqxA3          -----------------------------AKTPIVLISGGVGLTPMVSMLKVALQAPPR--QVVFVHGAR
1fdrA2          -----------------------------HCETLWMLATGTAIGPYLSILRLGKDLDRFKN-LVLVHAAR
1gvhA3          -----------------------------DDTPVTLISAGVGQTPMLAMLDTLAKAGHTAQ-VNWFHAAE
1qfjA1          VMDRI---LKDHQIVVDIPHGEAW----------------------------------------------
2piaA2          -----------------------------RAKSFILVAGGIGITPMLSMAR--QLRAEGLRSFRLYYLTR
1krhA2          ------------------------------KRPVLMLAGGTGIAPFLSMLQVL-EQKGSEHPVRLVFGVT
1a8pA2          -----------------------------PGKHLYMLSTGTGLAPFMSLIQDPEVYERFEK-VVLIHGVR
1qfjA2          ------------------------------ERPMILIAGGTGFSYARSILLTALARNPNRD-ITIYWGGR
1krhA1          MSEYLSVQAAGDKMSFTGPFGSFY----------------------------------------------
1pvwA           TIKKLAELVPGHVTLLRAAEGLVKNRQG-HTEMTVALAELANLVPITTICEMMGDDGNAMSKETKRYAEK
1a8pA1          LTSRLQHLKEGDELVSRKPTGT------------------------------------------------
1ep1B1          GTYKLSKLESGAKVDVMGPLGNGF----------------------------------------------
1b2rA2          -------------------------------ANVIMLATGTGIAPMRTYLWRMFKDAERAANPWLVFGVP
1cqxA2          VSNLLHDHVVGDQVKLAAPYGS------------------------------------------------
1cneA1          NEHPKFPNGVGSYIDVKGPLGH------------------------------------------------
1tvcA1          FSDYLRNDAVGQVLSVKGPLG-------------------------------------------------
1hhsA           ILLYDSRREPGSAIFVNSMLNNQF---------SPEYGVQSG------VRDRSKRKRPFPGLAWASMKDT
2piaA1          SISFIDDTSEGDAVEVSLP---------------------------------------------------
1b2rA1          CSTYLTHIEPGSEVKITGPVGKEM----------------------------------------------


                         +         .         .         .         .         *         .:210
query           GPKDILFKDDMKEWEKNMNMIITVDSAEEGYEGNTGLVTKYIPELEIKDMDNVQVIVVGPPMMMKFTVLE
1ep1B2          SENVKILENEFSNLKNV-TLKIATD---DGSYGTKGHVGMLMNEI---DFEVDALYTCGAPAMLKAVAKK
1tvcA2          TEPELFYIDELKSLERNLTVKACVWHPSGDWEGEQGSPIDALREDLESSDANPDIYLCGPPGMIDAACEL
1cneA2          TEDDILLRDELDRWAADRLKVWYVIDQVEGWKYSVGFVTEAVLREHVPEGGDTLALASGPPPMIQFAISP
1t6lA2          --------------------VRESENSAVHVDLDFGVVADLLKWIGPCPTGTVQILVHAGPPAIKFILTN
1amoA3          SDEDYLYREELARFHKDGNVAFSREQAHKVYVQHLLKRDREHLWKLIHE-GGAHIYVCGDARNMAKDVQN
1cqxA3          NSAVHAMRDRLREAAKTYENLDLFVFYDQPLPEDVQGRDYDYQIEKSILLPDADYYICGPIPFMRMQHDA
1fdrA2          YAADLSYLPLMQELEKRYERIQTVVSRETAAGSLTGRIPALIESGELESTETSHVMLCGNPQMVRDTQQL
1gvhA3          NGDVHAFADEVKELGQSLPRFHTWYRQPKGQFDSEGLMDLSK-LEGAFSDPTMQFYLCGPVGFMQFTAKQ
1qfjA1          ----------------------------------------------------------------------
2piaA2          DPEGTAFFDELTSDEWRSDVKIHH----DHGDPTKAFDFWSVFE---KSKPAQHVYCCGPQALMDT-VRD
1krhA2          QDCDLVALEQLDALQQKLPWFRTVVAHAESQHERKGYVTGHIEYDWL-NGGEVDVYLCGPVPMVEAVRSW
1a8pA2          QVNELAYQQFITEHLPQSEYFIYYPTVTRESFHNQGRLTDLMRSLPPINPQDDRAMICGSPSMLDESCEV
1qfjA2          EEQHLYDLCELEALSLGLQVVPVVEQPEAGWRGRTGTVLTAVLQDHG-TLAEHDIYIAGRFEMAKIARDL
1krhA1          ----------------------------------------------------------------------
1pvwA           HNLIYLSGEEIINY--------------------------------------------------------
1a8pA1          ----------------------------------------------------------------------
1ep1B1          ----------------------------------------------------------------------
1b2rA2          TTPNILYKEELEEIQQNFRLTYAISREQKNPQGGRMYIQDRVAEHQLWQLQKTHTYICGLRGMEE-GIDA
1cqxA2          ----------------------------------------------------------------------
1cneA1          ----------------------------------------------------------------------
1tvcA1          ----------------------------------------------------------------------
1hhsA           YGACPIYSDVLEAIERCW----------------------------------------------------
2piaA1          ----------------------------------------------------------------------
1b2rA1          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           FLKRGIKEENIWISQERKMCCGLGKCGHCKIDDTYICLDGPVFNYTKxxxxxx
1ep1B2          YDQLERLYISME----SRMACGIGACYACVEHALKVCEDGPVFLGKQ------
1tvcA2          VRSRGIPGEQ--VFFEKFLPSGAA-----------------------------
1cneA2          NLEMKYDMANSF-----------------------------------------
1t6lA2          GSELEFTSNNR-------VSFHGVKNMRINVQLKNFYQTLLNCAVTK------
1amoA3          TFDIVAEFGPM------------------------------------------
1cqxA3          LKNLGIHEARIH-----------------------------------------
1fdrA2          LKETRQMTKHL------------------------------------------
1gvhA3          LVDLGVKQENI------------------------------------------
1qfjA1          -----------------------------------------------------
2piaA2          MTG-HWPSGTV------------------------------------------
1krhA2          LDTQGIQPANFL-----------------------------------------
1a8pA2          LDGFGLKISPRM-----------------------------------------
1qfjA2          FCSRNAREDRLF-----------------------------------------
1krhA1          -----------------------------------------------------
1pvwA           -----------------------------------------------------
1a8pA1          -----------------------------------------------------
1ep1B1          -----------------------------------------------------
1b2rA2          ALSAAAKEGVTWSDYQKDL----------------------------------
1cqxA2          -----------------------------------------------------
1cneA1          -----------------------------------------------------
1tvcA1          -----------------------------------------------------
1hhsA           -----------------------------------------------------
2piaA1          -----------------------------------------------------
1b2rA1          -----------------------------------------------------