[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for cper0:BAB81146.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1nekB1.bssp"
#ERROR : Can't open dsspfile "1xerA.bssp"
#ERROR : Can't open dsspfile "1e7pB1.bssp"
#ERROR : Can't open dsspfile "1g8jA2.bssp"
#ERROR : Can't open dsspfile "2fug91.bssp"
#ERROR : Can't open dsspfile "1agmA.bssp"
#ERROR : Can't open dsspfile "2fug34.bssp"
#ERROR : Can't open dsspfile "1b0pA5.bssp"
#ERROR : Can't open dsspfile "1kf6B1.bssp"
#ERROR : Can't open dsspfile "1gt8A5.bssp"
#ERROR : Can't open dsspfile "1d0cA.bssp"

## Summary of PDB Search
:338
    4e-06  16%  1nekB1 [a.1.2.1] SUCCINATE DEHYDROGENASE IRON-SULFUR PROTEIN B:107
    7e-06  15%  1xerA  [d.58.1.3] FERREDOXIN
    1e-05  18%  1e7pB1 [a.1.2.1] FUMARATE REDUCTASE IRON-SULFUR PROTEIN B:107 --
    6e-05  10%  1g8jA2 [c.81.1.1] ARSENITE OXIDASE A:6 -- 682
    6e-05  24%  2fug91 [d.58.1.5] NADH-QUINONE OXIDOREDUCTASE CHAIN 9 9:26 -- 179
    8e-05   6%  1agmA  [a.102.1.1] GLUCOAMYLASE-471
    1e-04  13%  2fug34 [d.58.1.5] NADH-QUINONE OXIDOREDUCTASE CHAIN 3 3:96 -- 246
    1e-04  17%  1b0pA5 [d.58.1.5] PROTEIN (PYRUVATE-FERREDOXIN OXIDOREDUCTASE)
    1e-04  15%  1kf6B1 [a.1.2.1] FUMARATE REDUCTASE IRON-SULFUR PROTEIN B:106 --
    2e-04  13%  1gt8A5 [d.58.1.5] DIHYDROPYRIMIDINE DEHYDROGENASE A:845 -- 1020
    5e-04  10%  1d0cA  [d.174.1.1] BOVINE ENDOTHELIAL NITRIC OXIDE SYNTHASE HEME
:338

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxEIDSINDIEFSKKSDFSYKEVLLPIT
1nekB1          ----------------------------------------------------------------------
1xerA           ----------------------------------------------------------------------
1e7pB1          ----------------------------------------------------------------------
1g8jA2          ----------------------------------------------------------------------
2fug91          ----------------------------------------------------------------------
1agmA           --------------------------------------------FGQWLLDNGYTSAATEIVWPLVRNDL
2fug34          ----------------------------------------------------------------------
1b0pA5          ----------------------------------------------------------------------
1kf6B1          ----------------------------------------------------------------------
1gt8A5          ----------------------------------------------------------------------
1d0cA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           QTLFFFTEDKFSEASVEEKNILIFLRSCDMHSLRRIDDIYLRNGFEDPYYKKLREKAKFIVMGCENSFDN
1nekB1          ----------------------------------------------------------------------
1xerA           ----------------------------------------------------------------------
1e7pB1          ----------------------------------------------------------------------
1g8jA2          ----------------------------------------------------------------------
2fug91          ----------------------------------------------------------------------
1agmA           SYVAQYWNQTGYDLWEEVNGSSFFTIAVQHRALVEGSAFATAVGSSCSWCDSQAPQILCYLQSFWTGSYI
2fug34          ----------------------------------------------------------------------
1b0pA5          ----------------------------------------------------------------------
1kf6B1          ----------------------------------------------------------------------
1gt8A5          ----------------------------------------------------------------------
1d0cA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           CFCVSMGTNKTDEYSAYIGLDNDEVLLDIKDEELSKIFEAVESxxxxxxxxxxxxxxxxxxxPEGIDLNI
1nekB1          ----------------------------------------------------------------------
1xerA           ----------------------------------------------------------------GIDPNY
1e7pB1          ----------------------------------------------------------------------
1g8jA2          ----------------------------------------------------------------------
2fug91          ----------------------------------------------------------------------
1agmA           LANFDSSRSGKDTNTLLGSIHTDDSTFQPCSPRALANHKEVVD---------------------------
2fug34          ----------------------------------------------------------------------
1b0pA5          ----------------------------------------------------------------------
1kf6B1          --------------------------------------------------------------DQGTNIQT
1gt8A5          ----------------------------------------------------------------------
1d0cA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           IKSTVWNEYSERCIACGRCNFVCPTCTCFTMQDVFYKDNENAGERRRVWASCQVDGYTDMAGGHSFRKDK
1nekB1          ----------YECILCACCSTSCPSFWW------------------------NPDKFIGPAGLLAAYRFL
1xerA           R---TNRQVVGEHSGHKVYGPVEPPXVLGIHGTIVGVDFDLCIADGSCINACPVNVFQWYDTPGHPASE-
1e7pB1          -----------RCIECGCCIAAC---------GTKIMREDFVGAAGLNRVV--------RFMIDPHDERT
1g8jA2          ----ANAQRTNMIVGCGYHVYKWPEQLPPLASTLTPAMTNVVTEHDGARYDIMVVPDKACVVNSGLSSTR
2fug91          ----------EKCIGCSLCAAACPAYAI------------------------------------YVEPAE
1agmA           ----------------------------------------------------------------------
2fug34          ---------LNHPLDCPTCDKGGA-CELQDRTVEYGLYEKLPVYTRFEFTRRHVDKHHPLSPFVILDRER
1b0pA5          ----------ENCIQCNQCAFVCPHSAILPV---LAKEEELVGAPANFTALEAKGKELKGYKFRNTLDCM
1kf6B1          PAQMAKYHQFSGCINCGLCYAACPQFGLNPE-------------------------FIGPAAITLAHRYN
1gt8A5          -------------VIGKALQYLGTFGELSNIEQVVAVIDEEM---------CINCGKCYMTCNDSGYQAI
1d0cA           --SITYDTLCAQSQQDGPCTPRRCLGSLVLPRKLQTRPSPGP----PPAEQLLSQARDFINQYYSSIKRS


                         .         *         .         .         .         .         +:350
query           GQRMRFKVMHKVYDYKKRWGYHMCVGCGRCDDICPEYISFSECVNKLKDAVEEVKDNx
1nekB1          IDSRDTETDSRLDGLSDAFSVFRCHSIMNCVSVCPKGLNPTRAIGHIKSMLLQ-----
1xerA           -------------KKADPVNEQACIFCMACVNVCP-----------------------
1e7pB1          DEDYYELIGDD-------DGVFGCMTLLACHDVCPKNLPLQSKIAYLRKMVSV-----
1g8jA2          GGKMASYMYTPTGDGKERLSAPRLYAADEWVDTTWDH-AMALYAGLIKKTLDS-----
2fug91          NDPENPVSAGERYAKVYEINMLRCIFCGLCEEACP-----------------------
1agmA           ----------------------------------------------------------
2fug34          CIHCKRCVRGVHTFIGTMDFGLPSGFSGNITDICP-----------------------
1b0pA5          GCGNCADIEKALVMQPLDTQRDAQVPNLEYAARIP-----------------------
1kf6B1          EDSRDHGKKERMAQLNSQNGVWSCTFVGYCSEVCPKHVDPAAAIQQGKVESSK-----
1gt8A5          QFD---------PETHLPTVTDTCTGCTLCLSVCPIDCIRMVSRTTPYEPKRGL----
1d0cA           GSQAHEERLQEVEAEVASTGTYHLRESELVFGAKQAWRNAPRCVGRIQWGKLQVFDA-