[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for cper0:BAB81193.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2nxoA1.bssp"
#ERROR : Can't open dsspfile "1us4A.bssp"
#ERROR : Can't open dsspfile "1dioA.bssp"
#ERROR : Can't open dsspfile "2cbiA2.bssp"
#ERROR : Can't open dsspfile "1h3dA1.bssp"

## Summary of PDB Search
:334
    1e-20  17%  2nxoA1 [c.94.1.1] HYPOTHETICAL PROTEIN SCO4506 A:5 -- 281
    6e-13  21%  1us4A  [c.94.1.1] PUTATIVE GLUR0 LIGAND BINDING CORE
    4e-09  11%  1dioA  [c.1.19.3] PROTEIN (DIOL DEHYDRATASE)
    5e-09  10%  2cbiA2 [c.1.8.10] HYALURONIDASE A:179 -- 495
    3e-05  15%  1h3dA1 [c.94.1.1] ATP-PHOSPHORIBOSYLTRANSFERASE A:5 -- 224
:334

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxAISIVKMIKEKPEIMKGLDI
2nxoA1          ----------------------------------------------------------------------
1us4A           --------------------------------------------------ATGIAKLVNDANV---GIRA
1dioA           ----------------------------------------------------------------------
2cbiA2          ----------------------------------------------------------------------
1h3dA1          ---------------------------------------------------------LHTQRLIAMAENM


                         .         .         *         .         .         .         .:140
query           NYSIVKGSDALVSKVLKGEGDICIVPSNVAAIAYNKEAKYKLAGTVGFGSLYVISSDDSVNSLEDLKGKD
2nxoA1          -FELTKDTPELSEQLVRGDLDIGPVTL--VEFLKNAD-DLVAFPDIAVGCDGPVMSCVSQVPLDRLDGAR
1us4A           NARSTGGSVANINAINAGEFEXALAQNDIAYYAYQGCCIPAFEGKRALAALYVARKDAGIRTVADLKGKR
1dioA           ----------------------------------------------ASSNDQTFTHSDMRRTARLLMQFL
2cbiA2          ----------------------------------------------------------------------
1h3dA1          PIDILRRDDDIPGLVMDGVVDLGIIGENVLERAQGEDPRYFTLRRLDFGGCRLSPVDEAWDGPLSLNGKR


                         +         .         .         .         .         *         .:210
query           VYNVGQGLTPDLIFKILLQNDGINPEKDLTLSYVNAASELAPLFIEGKAKYAVVPEPMLTQIMTKKPETK
2nxoA1          VALGSTSRTSVRLAQLLLSERGVQPDYYTCPP---DLSLMAAVLIGDAARANMIDGP---------RYGL
1us4A           VVVGDVGSGTEQNARQILEAYGLTFDDLGQAIRVS-ASQGIQLXQDKRADALFYTVGLGASAIQQLALTA
1dioA           PGTDFISSGYSAVPNYDNMFAGSNEDAEDFDDYNLKVDGGLRPVREEDVIAIRNKAARALQAVFAGMGLP
2cbiA2          ---------------------------------------------------GFYGTPWTHQDR-LDQIKF
1h3dA1          IATSYPHLLKRY-----LDQKGISFK------SCLLNGSVEVAPRAGLADAICDLVSTGATLEANGL--R


                         .         .         .         +         .         .         .:280
query           IVASLNEQWKEMSDSKMGYPQSSVIVKEDLAKNNSEAVQKILKEIDNSTKWANENKEEAGAFAEEVGITG
2nxoA1          DVHDLGALWKE--WTGLPFVFAVWAARRDYAEREPVITRKVHEAFLASRNLSLEEVEKVAEQAAR-WEAF
1us4A           LVAVDLNRIQA-----------------------------------------------------------
1dioA           PI-----------TDEEVEAATYAHGSKDMPERNIVEDIKFAQEI----INKNRNGLEVKALAQGGFTDV
2cbiA2          YGENKLNTYI-------YAPKDDPYHREKWREPYPESEMQRMQELINASAENKVDFVFGISP--------
1h3dA1          EVEVI-----------YRSKACLIQRDGEMEESKQQLIDKLLTRIQ------------------------


                         .         *         .         .         .         .         +:350
query           KKEIIAKSLERANLNYVSALDSESEYIKYYDKIYSLEPKAIGGKKVNEEIFxxx
2nxoA1          DEDTLAKYFTTLDFRFGA--PQLEAVTEFARR---VGPTTGFPADVKVELL---
1us4A           ------------------------------------------------------
1dioA           AQDMLNIQKAK-------------------------------------------
2cbiA2          ------------------------------------------------------
1h3dA1          ------------------------------------------------------