[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for cper0:BAB81206.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2c2aA2.bssp"

## Summary of PDB Search
:440
    1e-04  15%  2c2aA2 [d.122.1.3] SENSOR HISTIDINE KINASE A:321 -- 481
:440

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2c2aA2          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2c2aA2          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2c2aA2          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2c2aA2          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxNEVLDVILNNKREKCMENNISLKVFIDFSKVNFIEYFDICTIFSNCIDNAIEACK
2c2aA2          ---------------CDLVESAVNAIKEFASSHNVNVLFESNVPCPVEAYITRIRQVLLNLLNNGVK-YS


                         .         .         .         .         *         .         .:420
query           KIKDNNRYISLKGNCVNNFYVIKIENSKTNKIKKLNGDFLTDKKDKFLHGIGLKNIRLALEKYNGEIIIE
2c2aA2          KKDAPDKYVKVILDEKDGGVLIIVEDNGIGIPDHAK-DRIFEQFYRVDTGLGLAITKEIVELHGGRIWVE


                         .         .         +         .         .         .         .:490
query           PLDDKFILKMLIPINQxxxx
2c2aA2          SEVGKSRFFVWIPKDR----